DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ack-like and AgaP_AGAP003986

DIOPT Version :9

Sequence 1:NP_001260935.1 Gene:Ack-like / 36442 FlyBaseID:FBgn0263998 Length:1495 Species:Drosophila melanogaster
Sequence 2:XP_003436676.1 Gene:AgaP_AGAP003986 / 1278803 VectorBaseID:AGAP003986 Length:1143 Species:Anopheles gambiae


Alignment Length:281 Identity:99/281 - (35%)
Similarity:155/281 - (55%) Gaps:18/281 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   128 IPADSISVNKQLGTGEFGIVQQGVWSNGNERIQVAIKCLCRERMQSNPMEFLKEAAIMHSIEHEN 192
            |..:.:.:.:.:|.||||.|..|:....    :||:|.|......||  :||.||.:|.::||||
Mosquito   880 IKMEDLQLKENIGKGEFGDVMLGIMKGE----KVAVKVLKDAGRASN--KFLAEAGVMTTLEHEN 938

  Fly   193 IVRLYGVVLATDSLMLVTELAHLRSLLECLKDSGLRVSFLTIPTLCEFALQICNGMRYLEQKRLI 257
            :|:..|:|.....:.||||.....||::.|:..|.:  .::......||...|.||.|||.|::|
Mosquito   939 LVKFIGLVFHDKYIYLVTEYMSKGSLVDYLRSRGRQ--HISRKDQINFAYDTCCGMEYLETKKVI 1001

  Fly   258 HRDLAARNILVFSKDKVKISDFGLSRALGVGKDYYKTNFNVNLKLPIAWCAPECINYLRFTNASD 322
            ||||||||:|:......|:|||||:|     .:.|..:   :.||||.|.|||.:...:|:|.:|
Mosquito  1002 HRDLAARNVLISEDCVAKVSDFGLAR-----DERYTGD---SSKLPIKWTAPEALKEGKFSNKTD 1058

  Fly   323 VWAFGVCLWEMFSYGFQPWAALTGLQILEAIDAPNYQRLEQPDCCPSEYYTLMMKCWQDDAAKRP 387
            :|:||:.|||::|:|..|:..:....:::.:.: .| ::|.|:.||.|.|.:|.:.|.....|||
Mosquito  1059 MWSFGILLWEIYSFGRVPYPRIPLADVVKHVGS-GY-KMEAPEGCPPEIYEMMRQAWDLVPEKRP 1121

  Fly   388 RFGEIYDQLPDMKPEQLKAVV 408
            .|.|:..:|.:.|.|.....|
Mosquito  1122 TFAELKRRLYNCKRETANTYV 1142

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ack-likeNP_001260935.1 SAM_TNK-like 4..65 CDD:188938
STYKc 133..396 CDD:214568 94/262 (36%)
PTKc_Ack_like 137..398 CDD:270636 95/260 (37%)
SH3 400..454 CDD:214620 3/9 (33%)
CRIB 486..525 CDD:238077
AgaP_AGAP003986XP_003436676.1 SH2_csk_like 770..866 CDD:198190
PTKc_Csk_like 878..1132 CDD:270635 96/269 (36%)
STYKc 885..1130 CDD:214568 94/262 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D539311at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.