DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ack-like and AgaP_AGAP008813

DIOPT Version :9

Sequence 1:NP_001260935.1 Gene:Ack-like / 36442 FlyBaseID:FBgn0263998 Length:1495 Species:Drosophila melanogaster
Sequence 2:XP_314941.3 Gene:AgaP_AGAP008813 / 1275672 VectorBaseID:AGAP008813 Length:1247 Species:Anopheles gambiae


Alignment Length:444 Identity:105/444 - (23%)
Similarity:159/444 - (35%) Gaps:163/444 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   123 NNKHIIPADSISVNKQLGTGEFGIVQ----QGVWSNGNERIQVAIKCLCRERMQSNPMEFLKEAA 183
            |:::..|.:.:.:.||||||.||:|.    |.:..|.:| ..||:|.:.::.........:.|..
Mosquito   775 NSEYEFPKERLKLGKQLGTGAFGVVMKATAQRIMVNEDE-TTVAVKMVKKQTDNEVMRALVSELK 838

  Fly   184 IM-HSIEHENIVRLYGVV---LATDSLMLVTELAHLRSL-------------------------- 218
            || |..:|.|:|.|.|.|   :|...||::.|.....::                          
Mosquito   839 IMVHLGQHLNVVNLLGAVTKNIAKRELMVIVEYCRFGNVQNFLLKHRPHFIDQINQETGEIDSSI 903

  Fly   219 -------------------LECLK----------------------------DSG---------- 226
                               ::.||                            |||          
Mosquito   904 DKNQLRWSKCGYQYNRYVRIQGLKYVNLSFSTNNVNHHPLQHPTAFYHNNHIDSGSTQYVDPKKH 968

  Fly   227 ------LRVSFL--------------------------------------------------TIP 235
                  :|.|.|                                                  |..
Mosquito   969 LNSKGYVRHSGLQNMGMVDSCNTEVTAMTSVEGEYLNSVNSNEPLWRSNYGMDYKGPARTVNTTD 1033

  Fly   236 TLCEFALQICNGMRYLEQKRLIHRDLAARNILVFSKDKVKISDFGLSRALGVGKDYYKTNFNVNL 300
            .:| :|.||..||.||..::::|.||||||||:...:.|||.||||:|::....:|.|..   ..
Mosquito  1034 LVC-WASQIACGMEYLASRKVLHGDLAARNILLCDDNVVKICDFGLARSMYKSDNYKKKG---EA 1094

  Fly   301 KLPIAWCAPECINYLRFTNASDVWAFGVCLWEMFSYGFQPWAALTGLQILEAIDAPNYQRLEQPD 365
            .||..|.|.|||....|:..|||||:|:.|||:||.|..|:..:...|.|.......| |:::|.
Mosquito  1095 PLPFKWLALECIGDNVFSTYSDVWAYGIVLWELFSLGKVPYPGMEANQELYNKLRDGY-RMDKPQ 1158

  Fly   366 CCPSEYYTLMMKCWQDDAAKRPRFGEIYDQLPDMKPEQLKAVVNCTEPKKDHLL 419
            ....:.|.:|:.||......||.|.::..:...|.|:.:          :||.|
Mosquito  1159 YSNQDIYDIMLNCWNVKPDSRPSFKDLKSRFNAMLPDDM----------RDHYL 1202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ack-likeNP_001260935.1 SAM_TNK-like 4..65 CDD:188938
STYKc 133..396 CDD:214568 98/409 (24%)
PTKc_Ack_like 137..398 CDD:270636 98/407 (24%)
SH3 400..454 CDD:214620 4/20 (20%)
CRIB 486..525 CDD:238077
AgaP_AGAP008813XP_314941.3 Ig 180..286 CDD:299845
IG <325..393 CDD:214652
Ig 528..601 CDD:143165
IG_like 621..702 CDD:214653
Ig 632..702 CDD:299845
PKc_like 777..1185 CDD:304357 99/413 (24%)
Pkinase_Tyr 785..1189 CDD:285015 98/409 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.