DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ack-like and hck

DIOPT Version :9

Sequence 1:NP_001260935.1 Gene:Ack-like / 36442 FlyBaseID:FBgn0263998 Length:1495 Species:Drosophila melanogaster
Sequence 2:XP_005174178.1 Gene:hck / 101885596 ZFINID:ZDB-GENE-090313-72 Length:499 Species:Danio rerio


Alignment Length:301 Identity:115/301 - (38%)
Similarity:170/301 - (56%) Gaps:20/301 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 SASACSSLAAKNGASSPSKVPNNKHI--IPADSISVNKQLGTGEFGIVQQGVWSNGNERIQVAIK 164
            |...|.||.:...:..|.| |..|..  ||.:|:.::|:||.|:||.|...::   |:..:||:|
Zfish   202 SDGLCQSLTSPCLSPKPQK-PWEKDAWEIPRESLKLDKRLGAGQFGEVWMAMY---NKHTKVAVK 262

  Fly   165 CLCRERMQSNPME-FLKEAAIMHSIEHENIVRLYGVVLATDSLMLVTELAHLRSLLECLK-DSGL 227
            .:   :..|..:| ||.||.:|.|::|:.:|||..||...:.:.::||.....|||:.:| |.|.
Zfish   263 TM---KPGSMSVEAFLMEANLMKSLQHDKLVRLNAVVTKEEPIYIITEFMEKGSLLDFIKSDEGN 324

  Fly   228 RVSFLTIPTLCEFALQICNGMRYLEQKRLIHRDLAARNILVFSKDKVKISDFGLSRALGVGKDYY 292
            ||.   :|.|.:|:.||..||.|:||:..|||||.|.||||......||:||||:|.: ...:| 
Zfish   325 RVQ---LPKLIDFSAQIAEGMAYIEQRNYIHRDLRAANILVNKSLVCKIADFGLARII-EDNEY- 384

  Fly   293 KTNFNVNLKLPIAWCAPECINYLRFTNASDVWAFGVCLWEMFSYGFQPWAALTGLQILEAIDAPN 357
              ......|.||.|.|||.|||..||..||||:||:.|.|:.|||..|:..:|..:::.|::. .
Zfish   385 --TAREGAKFPIKWTAPEAINYGSFTIKSDVWSFGILLTEIISYGRTPYPGMTNPEVIRALER-G 446

  Fly   358 YQRLEQPDCCPSEYYTLMMKCWQDDAAKRPRFGEIYDQLPD 398
            | |:::.|.||.|.|.:|::||::....||.|..:...|.|
Zfish   447 Y-RMQRLDSCPQELYDIMLECWKNKPEDRPTFEYLQSVLED 486

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ack-likeNP_001260935.1 SAM_TNK-like 4..65 CDD:188938
STYKc 133..396 CDD:214568 102/264 (39%)
PTKc_Ack_like 137..398 CDD:270636 103/262 (39%)
SH3 400..454 CDD:214620
CRIB 486..525 CDD:238077
hckXP_005174178.1 SH3 58..109 CDD:302595
SH2 113..215 CDD:301589 4/12 (33%)
PTKc_Hck 222..487 CDD:270658 108/280 (39%)
Pkinase_Tyr 234..484 CDD:285015 102/264 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D539311at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.