DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ack-like and LOC100491469

DIOPT Version :9

Sequence 1:NP_001260935.1 Gene:Ack-like / 36442 FlyBaseID:FBgn0263998 Length:1495 Species:Drosophila melanogaster
Sequence 2:XP_031750439.1 Gene:LOC100491469 / 100491469 -ID:- Length:489 Species:Xenopus tropicalis


Alignment Length:213 Identity:76/213 - (35%)
Similarity:124/213 - (58%) Gaps:11/213 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   129 PADSISVNKQLGTGEFGIVQQGVWSNGNERIQVAIKCLCRERMQSNPMEFLKEAAIMHSIEHENI 193
            |.....:.:|||.|.||.|.:|:|:|   :.:||||...::.:  |..:|.||...:.::.|:|:
 Frog   219 PRSEFKLVRQLGAGNFGEVWEGLWNN---KDKVAIKTFKQDNI--NESDFKKEVNALKTLCHKNL 278

  Fly   194 VRLYGVVLATDSLMLVTELAHLRSLLECLKDSGLRVSFLTIPTLCEFALQICNGMRYLEQKRLIH 258
            ::||.|....:.:.:||||....|||:.|:  |.....||..:......|:..||.:||::.::|
 Frog   279 IQLYAVCSVGEPVYIVTELMSKGSLLQFLR--GTEGRHLTAGSFMHIISQVAEGMVFLEKEHVVH 341

  Fly   259 RDLAARNILVFSKDKVKISDFGLSRALGVGKDYYKTNFNVNLKLPIAWCAPECINYLRFTNASDV 323
            |||||||:||..|...|::||||:|.|  ..|.|  :...|:|:||.|.|||.:....::..|||
 Frog   342 RDLAARNVLVGEKLVCKVADFGLARIL--KDDLY--SLQGNIKIPIKWTAPEVLTRSIYSTKSDV 402

  Fly   324 WAFGVCLWEMFSYGFQPW 341
            |::|:.::|::..|..|:
 Frog   403 WSYGIVMYEVYMLGQMPY 420

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ack-likeNP_001260935.1 SAM_TNK-like 4..65 CDD:188938
STYKc 133..396 CDD:214568 75/209 (36%)
PTKc_Ack_like 137..398 CDD:270636 75/205 (37%)
SH3 400..454 CDD:214620
CRIB 486..525 CDD:238077
LOC100491469XP_031750439.1 SH3_Srms 46..100 CDD:212780
SH2 113..191 CDD:417686
PKc_like 216..>422 CDD:419665 76/213 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D539311at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.