DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ack-like and fgfr3

DIOPT Version :9

Sequence 1:NP_001260935.1 Gene:Ack-like / 36442 FlyBaseID:FBgn0263998 Length:1495 Species:Drosophila melanogaster
Sequence 2:XP_012812743.1 Gene:fgfr3 / 100196923 XenbaseID:XB-GENE-479255 Length:829 Species:Xenopus tropicalis


Alignment Length:365 Identity:107/365 - (29%)
Similarity:184/365 - (50%) Gaps:46/365 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 SYLSKI--KRLLQAPGTMVKREEAPGGGSQVALDGSSASACSS-------LAAKNGASSPSKVPN 123
            :|..|:  |:.:.|| .:.|..:.|....||:|:.:|:...::       |::.:|    :.:.|
 Frog   411 TYRVKVPSKKAMSAP-PVHKVSKFPLKRQQVSLESNSSMNSNTPLVRITHLSSSDG----TMLAN 470

  Fly   124 NKHI-IPAD--------SISVNKQLGTGEFG--IVQQGVW---SNGNERIQVAIKCLCRERMQSN 174
            ...: :|.|        .:::.|.||.|.||  ::.:.:.   ...|:.:.||:|.|..:....:
 Frog   471 VSELGLPLDPKWELLRTRLTLGKPLGEGCFGQVVMAEAIGIEKERPNKPVTVAVKMLKDDATDKD 535

  Fly   175 PMEFLKEAAIMHSI-EHENIVRLYGVVLATDSLMLVTELA---HLRSLLECLKDSGLRVSF---- 231
            ..:.:.|..:|..| :|:||:.|.|.......|.::.|.|   :||..|:..:..|:..||    
 Frog   536 LSDLVSEMEMMKMIGKHKNIINLLGACTQDGPLYVLVEYASKGNLREYLKARRPPGMDYSFDTCK 600

  Fly   232 -----LTIPTLCEFALQICNGMRYLEQKRLIHRDLAARNILVFSKDKVKISDFGLSRALGVGKDY 291
                 ||...|...|.|:..||.||..::.|||||||||:||...:.:||:||||:|.:. ..||
 Frog   601 IPAEQLTFKDLVSCAYQVARGMEYLASQKCIHRDLAARNVLVTDDNVMKIADFGLARDIH-NIDY 664

  Fly   292 YKTNFNVNLKLPIAWCAPECINYLRFTNASDVWAFGVCLWEMFSYGFQPWAALTGLQILEAIDAP 356
            ||.  ..|.:||:.|.|||.:....:|:.||||::||.|||.|:.|..|:..:...::.:.:...
 Frog   665 YKK--TTNGRLPVKWMAPEALFDRIYTHQSDVWSYGVLLWETFTLGGSPYPGIPVEELFKLLKEG 727

  Fly   357 NYQRLEQPDCCPSEYYTLMMKCWQDDAAKRPRFGEIYDQL 396
            :  |:::|..|..|.|.:|.:||....::||.|.::.:.|
 Frog   728 H--RMDKPANCTHELYMIMRECWHAVPSQRPTFKQLVEDL 765

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ack-likeNP_001260935.1 SAM_TNK-like 4..65 CDD:188938
STYKc 133..396 CDD:214568 90/280 (32%)
PTKc_Ack_like 137..398 CDD:270636 91/278 (33%)
SH3 400..454 CDD:214620
CRIB 486..525 CDD:238077
fgfr3XP_012812743.1 IGc2 74..129 CDD:197706
Ig2_FGFR 177..261 CDD:143265
Ig3_FGFR 284..371 CDD:319280
PTKc_FGFR3 476..809 CDD:173652 93/295 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.