DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ack-like and prmt5

DIOPT Version :9

Sequence 1:NP_001260935.1 Gene:Ack-like / 36442 FlyBaseID:FBgn0263998 Length:1495 Species:Drosophila melanogaster
Sequence 2:XP_002941557.1 Gene:prmt5 / 100145788 XenbaseID:XB-GENE-975034 Length:633 Species:Xenopus tropicalis


Alignment Length:230 Identity:45/230 - (19%)
Similarity:77/230 - (33%) Gaps:79/230 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   331 WEMFSYGFQPWAALTGLQILEAIDAPNYQRLEQPDCCPSEYYTLMMKCWQDDAAKRPRFGEIYDQ 395
            :|||:.|::.:.......:::.:::..|:..|:.....|:|...:.||             :.|:
 Frog   293 YEMFAKGYEDYLQSPLQPLMDNLESQTYEVFEKDPVKYSQYQQAVYKC-------------LLDR 344

  Fly   396 LPDMKPEQLKAVVNCTEPKKDHLLYRQGDIISVLDRNTGTPFWKGVLSTGKTG------YF---N 451
            :|:             |.|:.::     .::.||....| |.....|...|..      |.   |
 Frog   345 VPE-------------EEKETNI-----QVLMVLGAGRG-PLVNASLRAAKQAERKIKVYAVEKN 390

  Fly   452 PSNTVAFLEG----------------------------LPSSTRDSFSRVSDHRISKRKLRTEMI 488
            | |.|..|||                            :.|....||   .|:.:|     .|.:
 Frog   391 P-NAVITLEGWRYEEWGSQVTVVSGDMREWKAPEKADIIVSELLGSF---GDNELS-----PECL 446

  Fly   489 SKPQNDFKHTGHVGIDGATFGDIAFLGSSQNYNHV 523
            ...|:..|..| |.|.......:|.:.||:.||.|
 Frog   447 DGAQHFLKEDG-VSIPSEYTSYLAPISSSKLYNEV 480

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ack-likeNP_001260935.1 SAM_TNK-like 4..65 CDD:188938
STYKc 133..396 CDD:214568 11/64 (17%)
PTKc_Ack_like 137..398 CDD:270636 11/66 (17%)
SH3 400..454 CDD:214620 11/62 (18%)
CRIB 486..525 CDD:238077 12/38 (32%)
prmt5XP_002941557.1 PRMT5_TIM 32..286 CDD:375105
PRMT5 291..460 CDD:368326 38/208 (18%)
PRMT5_C 464..631 CDD:375106 6/17 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0199
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.