Sequence 1: | NP_001260935.1 | Gene: | Ack-like / 36442 | FlyBaseID: | FBgn0263998 | Length: | 1495 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_002941557.1 | Gene: | prmt5 / 100145788 | XenbaseID: | XB-GENE-975034 | Length: | 633 | Species: | Xenopus tropicalis |
Alignment Length: | 230 | Identity: | 45/230 - (19%) |
---|---|---|---|
Similarity: | 77/230 - (33%) | Gaps: | 79/230 - (34%) |
- Green bases have known domain annotations that are detailed below.
Fly 331 WEMFSYGFQPWAALTGLQILEAIDAPNYQRLEQPDCCPSEYYTLMMKCWQDDAAKRPRFGEIYDQ 395
Fly 396 LPDMKPEQLKAVVNCTEPKKDHLLYRQGDIISVLDRNTGTPFWKGVLSTGKTG------YF---N 451
Fly 452 PSNTVAFLEG----------------------------LPSSTRDSFSRVSDHRISKRKLRTEMI 488
Fly 489 SKPQNDFKHTGHVGIDGATFGDIAFLGSSQNYNHV 523 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Ack-like | NP_001260935.1 | SAM_TNK-like | 4..65 | CDD:188938 | |
STYKc | 133..396 | CDD:214568 | 11/64 (17%) | ||
PTKc_Ack_like | 137..398 | CDD:270636 | 11/66 (17%) | ||
SH3 | 400..454 | CDD:214620 | 11/62 (18%) | ||
CRIB | 486..525 | CDD:238077 | 12/38 (32%) | ||
prmt5 | XP_002941557.1 | PRMT5_TIM | 32..286 | CDD:375105 | |
PRMT5 | 291..460 | CDD:368326 | 38/208 (18%) | ||
PRMT5_C | 464..631 | CDD:375106 | 6/17 (35%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG0199 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |