DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13326 and AT1G67530

DIOPT Version :10

Sequence 1:NP_610838.1 Gene:CG13326 / 36439 FlyBaseID:FBgn0033794 Length:867 Species:Drosophila melanogaster
Sequence 2:NP_176920.1 Gene:AT1G67530 / 843074 AraportID:AT1G67530 Length:782 Species:Arabidopsis thaliana


Alignment Length:174 Identity:39/174 - (22%)
Similarity:61/174 - (35%) Gaps:63/174 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 TSLNLIKSTVRVAQMARNHFLAKGPTNEQRSVPLLVASIGPYGAHLHDGSEYTGRYAADVCADTI 149
            :::.:.|::|:....||...||:|  .||    :|                ||...|..:.|.. 
plant   100 SNMQIPKASVKKVFCARRKKLAEG--TEQ----IL----------------YTSNIAFPIAAAI- 141

  Fly   150 QKWHRPRIDACLEAGVDV-----LGIETIPCKMEAEALLDML--CDEYPTVRFWI---------- 197
                 .||....:.|::.     |..|||     :|.||..:  ..|.|.|...:          
plant   142 -----KRIQTSEKEGINSAEGNRLSPETI-----SEMLLSAMHKVGETPDVSIKVCKGHINFLSS 196

  Fly   198 ---SFQCKD---NQHLANGELFADTVNSLWAK-------ARSRR 228
               ||..:|   |.:::.|....|...:|.||       ||.|:
plant   197 AKDSFSDRDVVPNGNISRGANSLDGSETLHAKKDSENHQARKRK 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13326NP_610838.1 EDR1 <758..799 CDD:433922
AT1G67530NP_176920.1 RING-Ubox_PUB 273..325 CDD:438326
armadillo repeat 468..497 CDD:293788
armadillo repeat 505..539 CDD:293788
armadillo repeat 553..579 CDD:293788
armadillo repeat 586..623 CDD:293788
armadillo repeat 629..660 CDD:293788
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.