DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13326 and AT1G44120

DIOPT Version :10

Sequence 1:NP_610838.1 Gene:CG13326 / 36439 FlyBaseID:FBgn0033794 Length:867 Species:Drosophila melanogaster
Sequence 2:NP_001321524.1 Gene:AT1G44120 / 841015 AraportID:AT1G44120 Length:2141 Species:Arabidopsis thaliana


Alignment Length:99 Identity:19/99 - (19%)
Similarity:38/99 - (38%) Gaps:18/99 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   197 ISFQCKDNQHLANGELFADTVNS----LWAKARSRRAKNLLA---------LGVNCVHPQIVTPL 248
            :.....:|.:....|:|....|.    ::...:|||.::.||         :.|.|...:::..:
plant    37 VKLDANENPYGPPPEVFEALGNMKFPYVYPDPQSRRLRDALAQDSGLESEYILVGCGADELIDLI 101

  Fly   249 FRSVNEKKLPAVRIPLIVYPNSGEVYTVEDGWQG 282
            .|.|.:   |..:|  |..|.:..:|..:....|
plant   102 MRCVLD---PGEKI--IDCPPTFSMYVFDAAVNG 130

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13326NP_610838.1 EDR1 <758..799 CDD:433922
AT1G44120NP_001321524.1 PLN03200 28..2139 CDD:215629 19/99 (19%)
armadillo repeat 42..69 CDD:293788 4/26 (15%)
armadillo repeat 77..114 CDD:293788 8/41 (20%)
armadillo repeat 120..150 CDD:293788 2/11 (18%)
armadillo repeat 219..244 CDD:293788
armadillo repeat 254..287 CDD:293788
armadillo repeat 295..340 CDD:293788
armadillo repeat 346..374 CDD:293788
armadillo repeat 476..501 CDD:293788
armadillo repeat 509..546 CDD:293788
armadillo repeat 598..662 CDD:293788
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.