DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13326 and AT1G08315

DIOPT Version :10

Sequence 1:NP_610838.1 Gene:CG13326 / 36439 FlyBaseID:FBgn0033794 Length:867 Species:Drosophila melanogaster
Sequence 2:NP_849613.1 Gene:AT1G08315 / 837352 AraportID:AT1G08315 Length:325 Species:Arabidopsis thaliana


Alignment Length:206 Identity:36/206 - (17%)
Similarity:72/206 - (34%) Gaps:48/206 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   386 EGAIRKLVAILMSPDVAIKAREQAGEFL-----------SRLLVA----------AFRETAAQLQ 429
            |.|.|:.::.::|...::..:.:|....           |||::|          ....::...|
plant     2 ETAKRRTMSTIVSRLSSVSEQTRAAALAELRLISKQDPDSRLIIADAGAIPYLAETLYSSSHSSQ 66

  Fly   430 EQDIAVVLTAVIAQGQPTLS----IDLILLLL-----------------TIIESLAQKEEYRTIL 473
            |...|.:|...|...:|.:|    :|.:...|                 ||...|..:|.||.|:
plant    67 ENAAATLLNLSITSREPLMSSRGLLDALSHALRHHDTTTSPAAVQSSAATIYSLLIAEESYRPII 131

  Fly   474 GEYSSLTEQLAQLLMRSFAHSILVNNIFRCLCTLIDEAPVRETLLANYIVSSMKRALKSLSNLVK 538
            |....:...|..::....:|...:.:..:.|..:......|.|:::...:.::      .|.:||
plant   132 GSKRDIIFSLIHIIRYPDSHPRSIKDSLKALFAIALYPMNRSTMISLGAIPAL------FSLIVK 190

  Fly   539 TSVTNFILQTT 549
            .|....:...|
plant   191 DSRCGIVEDAT 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13326NP_610838.1 EDR1 <758..799 CDD:433922
AT1G08315NP_849613.1 armadillo repeat 9..34 CDD:293788 2/24 (8%)
Arm 38..77 CDD:425727 8/38 (21%)
armadillo repeat 42..77 CDD:293788 7/34 (21%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.