DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13326 and Rsph14

DIOPT Version :9

Sequence 1:NP_610838.1 Gene:CG13326 / 36439 FlyBaseID:FBgn0033794 Length:867 Species:Drosophila melanogaster
Sequence 2:NP_001157005.1 Gene:Rsph14 / 71236 MGIID:1918486 Length:374 Species:Mus musculus


Alignment Length:355 Identity:65/355 - (18%)
Similarity:120/355 - (33%) Gaps:141/355 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly   217 ICEVTNE----FQEIRKAALKTLKTLLADTGDDSVFEALHRCYFVLEQLVKVFCESPQGPEAADV 277
            :|::.::    ::.|....|::|||||.|  ||:              ||::        :..:|
Mouse    83 LCDLMHDPEYVYEAINIGCLESLKTLLQD--DDN--------------LVRI--------KTTEV 123

  Fly   278 IEVLATALRSEKMTKL-FFEQNLFDQVVEQVRNHMDLMPLEMRCTIISIFAETAQYEQFLPRMHK 341
            :.::||    ..:.:: |.:.::...:...:.:|..|      |.                    
Mouse   124 LYIMAT----HYVGRVGFLKHDIIQALSLLLSDHQTL------CR-------------------- 158

  Fly   342 AEIADMFLTCLMQNKPAPAAYVIQGLHRMSHH----PEALRRIVAAYQEGAIRKLVAILMSPD-- 400
                                   :.||:...|    |:..:.||   |.|.|..||..|...:  
Mouse   159 -----------------------ENLHQAYKHLAQLPKGAQGIV---QSGLIPSLVRKLQKEEDH 197

  Fly   401 --------VAIKAREQAGEFLSRLLVAAFRETAAQLQEQDIAVVLTAVIAQGQPTLSIDL----- 452
                    :|:..:|.|.|.|....|...:|.......:..:....|:||     :||.|     
Mouse   198 IQEIILDTLALCLQEDATEALESQAVPCLKEKLLSQNSEIRSKAARALIA-----ISIPLDGKNQ 257

  Fly   453 ------ILLLLTIIESLAQKEEYR------------TILGEYSSLTEQLAQLLMRSFAHSILVNN 499
                  |.:|:|::..  ..||.:            |..|:|::|.....:.|:     .:|..|
Mouse   258 VWKNKVIPILVTLLSD--TDEEVKANAAGALMHATVTTEGKYAALDANAIEPLL-----ELLSTN 315

  Fly   500 IFRCLC-------TLIDEAPVRETLLANYI 522
            ....||       |::.|||....||.:::
Mouse   316 PKTKLCLNATKALTMLAEAPEGRKLLLSHV 345

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13326NP_610838.1 EDR1 <759..799 CDD:291079
Rsph14NP_001157005.1 HEAT repeat 102..126 CDD:293787 12/47 (26%)
HEAT repeat 142..170 CDD:293787 6/76 (8%)
ARM 176..286 CDD:237987 26/119 (22%)
HEAT_2 184..287 CDD:290374 22/109 (20%)
HEAT repeat 184..208 CDD:293787 4/23 (17%)
armadillo repeat 223..248 CDD:293788 5/29 (17%)
armadillo repeat 255..290 CDD:293788 5/36 (14%)
ARM 257..370 CDD:237987 20/96 (21%)
armadillo repeat 296..328 CDD:293788 7/36 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0167
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.