DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13326 and arvcfb

DIOPT Version :9

Sequence 1:NP_610838.1 Gene:CG13326 / 36439 FlyBaseID:FBgn0033794 Length:867 Species:Drosophila melanogaster
Sequence 2:XP_009299795.1 Gene:arvcfb / 564669 ZFINID:ZDB-GENE-060526-60 Length:1048 Species:Danio rerio


Alignment Length:255 Identity:55/255 - (21%)
Similarity:97/255 - (38%) Gaps:71/255 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   628 DILRNDCSPL---DAVLVMNFDRPKPNQNDVIAVPLRCLSTITDLPGDQGWGYCKRPGDNNLPQY 689
            ::||:|...:   .|:.:.|....:.|::.:.:..:|.|  :::||..|     :||..|.....
Zfish   805 ELLRSDSDKVVRAVAIALRNLSIDRRNKDLIGSYAMRDL--VSNLPSGQ-----QRPAKNLEEDT 862

  Fly   690 LEALNQTLAMHGLVENPERVRRTIDFENVAKRSKLIAQAVNAVMSENLKILDLNSTEECCRNT-V 753
            :.|:..|:  |.::        |...||.  ||.:.|||::       |::.:|.|.:..|.| .
Zfish   863 VVAILNTI--HEII--------TDSSENA--RSLITAQAID-------KLVAINRTSQSARETKA 908

  Fly   754 RCHL-------QELRHVL------HTNFIPLG---------------------MVRS----GCQF 780
            ..|:       :|||:.|      .|:|.|:.                     |.:|    ||..
Zfish   909 ASHVLQTVWSYKELRNALTKDGWNKTHFQPIAAGTPKGSKSCKPGYDDTTLPLMEKSQGHRGCSG 973

  Fly   781 ERAILFKGLADQIGLPCTLQRSVDGRMLYNELPLPLEPEKDVHCDKKTLKYMPWRMLRPT 840
            ...|....|... |.....||..|.:...:::...|:..:.:..|.....|:  |..|||
Zfish   974 GDMIPMDELGPD-GYSTIDQRDKDSKYKSSDISSDLQEREPLKNDTNRKHYI--RSNRPT 1030

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13326NP_610838.1 EDR1 <759..799 CDD:291079 14/70 (20%)
arvcfbXP_009299795.1 ARM 434..552 CDD:237987
armadillo repeat 439..464 CDD:293788
armadillo repeat 472..508 CDD:293788
armadillo repeat 515..550 CDD:293788
armadillo repeat 557..608 CDD:293788
ARM 745..849 CDD:237987 9/45 (20%)
armadillo repeat 745..781 CDD:293788
HEAT_2 757..>825 CDD:290374 4/19 (21%)
armadillo repeat 791..825 CDD:293788 4/19 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2332
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.