Sequence 1: | NP_610838.1 | Gene: | CG13326 / 36439 | FlyBaseID: | FBgn0033794 | Length: | 867 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_009299795.1 | Gene: | arvcfb / 564669 | ZFINID: | ZDB-GENE-060526-60 | Length: | 1048 | Species: | Danio rerio |
Alignment Length: | 255 | Identity: | 55/255 - (21%) |
---|---|---|---|
Similarity: | 97/255 - (38%) | Gaps: | 71/255 - (27%) |
- Green bases have known domain annotations that are detailed below.
Fly 628 DILRNDCSPL---DAVLVMNFDRPKPNQNDVIAVPLRCLSTITDLPGDQGWGYCKRPGDNNLPQY 689
Fly 690 LEALNQTLAMHGLVENPERVRRTIDFENVAKRSKLIAQAVNAVMSENLKILDLNSTEECCRNT-V 753
Fly 754 RCHL-------QELRHVL------HTNFIPLG---------------------MVRS----GCQF 780
Fly 781 ERAILFKGLADQIGLPCTLQRSVDGRMLYNELPLPLEPEKDVHCDKKTLKYMPWRMLRPT 840 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG13326 | NP_610838.1 | EDR1 | <759..799 | CDD:291079 | 14/70 (20%) |
arvcfb | XP_009299795.1 | ARM | 434..552 | CDD:237987 | |
armadillo repeat | 439..464 | CDD:293788 | |||
armadillo repeat | 472..508 | CDD:293788 | |||
armadillo repeat | 515..550 | CDD:293788 | |||
armadillo repeat | 557..608 | CDD:293788 | |||
ARM | 745..849 | CDD:237987 | 9/45 (20%) | ||
armadillo repeat | 745..781 | CDD:293788 | |||
HEAT_2 | 757..>825 | CDD:290374 | 4/19 (21%) | ||
armadillo repeat | 791..825 | CDD:293788 | 4/19 (21%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 1 | 1.030 | - | avgDist | Average_Evolutionary_Distance | R2332 |
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.030 |