DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13326 and ctnnd2b

DIOPT Version :9

Sequence 1:NP_610838.1 Gene:CG13326 / 36439 FlyBaseID:FBgn0033794 Length:867 Species:Drosophila melanogaster
Sequence 2:NP_001352544.1 Gene:ctnnd2b / 558069 ZFINID:ZDB-GENE-070912-532 Length:1229 Species:Danio rerio


Alignment Length:398 Identity:81/398 - (20%)
Similarity:122/398 - (30%) Gaps:139/398 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   197 QSADQMLDFTTQPDFP--------VDRIICEVTNEFQEIRKAALKTLKTLLADTGDDSVFEALHR 253
            |..||:|:|...|..|        ||.|..:.|..     :.|..|.......||..:.......
Zfish   420 QFCDQVLNFLLCPYSPVIAPSSPGVDSIPLQRTGS-----QNATGTFPRAGYATGPGASTADYAN 479

  Fly   254 CYFVLEQLVKVFCESPQGP--EAADVIEVLATALRS-------------------------EKMT 291
            .|..|:     ||.|...|  ::...:...||.:||                         ::||
Zfish   480 PYRTLQ-----FCPSTDSPYSKSGPALPPEATLVRSPSVDSIQKDPRYDPEFLVWNQNQAEQRMT 539

  Fly   292 KLF-FEQNLFDQVVEQVRNHMDLMPLEMRCTIISIFAETAQYEQFLPRMHKAEIADMFLTCLMQN 355
            |.| :......:|::.:::...           |:.:..|.|.|.|              |...|
Zfish   540 KEFGWRDPELPEVIQMLQHQFP-----------SVQSNAAAYLQHL--------------CFGDN 579

  Fly   356 KPAPAAYVIQGL--------HRMSH-HPEALRRIVAAYQEGAIRKLVAILMSPDVAIKAREQAG- 410
            |.........|:        |||:. |..|.         ||:|.||....:.|..|..:...| 
Zfish   580 KIKSEIRRQGGIQLLVDLLDHRMTDVHRSAC---------GALRNLVYGKANDDNKIALKNCGGI 635

  Fly   411 EFLSRLLVAAFRETAAQLQEQDIAVVLTAVI-------AQGQPTLSIDLILLLLTII-------- 460
            ..|.|||    |:|.    :.:|..:||.|:       |...|.:...|.:|..|:|        
Zfish   636 PALVRLL----RKTT----DVEIRELLTGVLWNLSSCDALKMPIIQDALAVLTNTVIIPHSGWDT 692

  Fly   461 -------------------------ESLAQKEEYRTILGEYSSLTEQLAQLLMRSFAHS-ILVNN 499
                                     ...:..||.|..:.|...||:.|..::..:...| |....
Zfish   693 SPLQDDRKLHLHSSQVLRNATGCLRNVSSAGEEARRRMRECEGLTDALLYVIQTALGTSEIDSKT 757

  Fly   500 IFRCLCTL 507
            |..|:|.|
Zfish   758 IENCVCIL 765

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13326NP_610838.1 EDR1 <759..799 CDD:291079
ctnnd2bNP_001352544.1 PLN03200 547..>720 CDD:331927 39/214 (18%)
armadillo repeat 549..574 CDD:293788 5/35 (14%)
ARM 578..618 CDD:214547 12/48 (25%)
armadillo repeat 582..618 CDD:293788 10/44 (23%)
ARM 622..663 CDD:214547 13/48 (27%)
armadillo repeat 626..661 CDD:293788 12/42 (29%)
armadillo repeat 668..719 CDD:293788 5/50 (10%)
Arm 831..872 CDD:278915
armadillo repeat 835..872 CDD:293788
ARM 889..924 CDD:214547
armadillo repeat 889..923 CDD:293788
armadillo repeat 930..980 CDD:293788
armadillo repeat 986..1021 CDD:293788
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2332
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.