DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13326 and ARVCF

DIOPT Version :9

Sequence 1:NP_610838.1 Gene:CG13326 / 36439 FlyBaseID:FBgn0033794 Length:867 Species:Drosophila melanogaster
Sequence 2:XP_006724306.1 Gene:ARVCF / 421 HGNCID:728 Length:1004 Species:Homo sapiens


Alignment Length:321 Identity:65/321 - (20%)
Similarity:110/321 - (34%) Gaps:104/321 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   223 EFQEIRKAALKTLKTLLA--DTGDDSVFEALHRCYFVLEQL----------VKVFCESPQGPEAA 275
            |.:.:..|.|..|::.:.  ||.:.||    ..|..::..|          ...:.|:..||   
Human   542 ECEGLVDALLHALQSAVGRKDTDNKSV----ENCVCIMRNLSYHVHKEVPGADRYQEAEPGP--- 599

  Fly   276 DVIEVLATALRSE-------------KMTKLFFEQNLFDQVVEQVRNHMDLMPLEMRCTIISIFA 327
                 |.:|:.|:             |..:.:|.|...|.  |..|| .|.:.|..|       .
Human   600 -----LGSAVGSQRRRRDDASCFGGKKAKEEWFHQGKKDG--EMDRN-FDTLDLPKR-------T 649

  Fly   328 ETAQYEQFLPRMHKAEIADMFLTCLMQ----NKPAPAAYVIQGLHRMSHHPEALRRIVAAYQEGA 388
            |.|:..:.|   ::.|:..::|:.|.:    |....||..:|.|       .|...:.|.|....
Human   650 EAAKGFELL---YQPEVVRLYLSLLTESRNFNTLEAAAGALQNL-------SAGNWMWATYIRAT 704

  Fly   389 IRK------LVAILMS-PDVAIKA--------------REQAGEFLSRLLVAAFRETAAQ----- 427
            :||      ||.:|.| .|..::|              ::..|.:....||...|...|.     
Human   705 VRKERGLPVLVELLQSETDKVVRAVAIALRNLSLDRRNKDLIGSYAMAELVRNVRNAQAPPRPGA 769

  Fly   428 -LQEQDIAVVLTAV---------------IAQGQPTLSIDLILLLLTIIESLAQKEEYRTI 472
             |:|..:..||..:               .|:|.|.| :.|:....::.|:.|.....:|:
Human   770 CLEEDTVVAVLNTIHEIVSDSLDNARSLLQARGVPAL-VALVASSQSVREAKAASHVLQTV 829

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13326NP_610838.1 EDR1 <759..799 CDD:291079
ARVCFXP_006724306.1 ARM 355..473 CDD:237987
HEAT_2 360..462 CDD:290374
armadillo repeat 360..385 CDD:293788
armadillo repeat 393..429 CDD:293788
armadillo repeat 436..471 CDD:293788
ARM 437..579 CDD:237987 9/40 (23%)
armadillo repeat 478..529 CDD:293788
ARM 656..756 CDD:237987 22/109 (20%)
armadillo repeat 656..692 CDD:293788 9/45 (20%)
armadillo repeat 702..736 CDD:293788 8/33 (24%)
armadillo repeat 743..788 CDD:293788 9/44 (20%)
armadillo repeat 794..826 CDD:293788 7/32 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2332
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.