DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13326 and ctnnb1

DIOPT Version :9

Sequence 1:NP_610838.1 Gene:CG13326 / 36439 FlyBaseID:FBgn0033794 Length:867 Species:Drosophila melanogaster
Sequence 2:XP_005157888.1 Gene:ctnnb1 / 30265 ZFINID:ZDB-GENE-980526-362 Length:789 Species:Danio rerio


Alignment Length:402 Identity:81/402 - (20%)
Similarity:145/402 - (36%) Gaps:121/402 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   180 PDTVFNSIEALHRMLLVQSADQMLDFTTQPDFPVDRIICEVTN--EFQEIRKAALKTLKTLLADT 242
            |.|.|:|....:...|.:.: |||          ...:..:.|  :..|:...|:..|..||.| 
Zfish   109 PSTQFDSAHPTNVQRLAEPS-QML----------KHAVVNLINYQDDAELATRAIPELTKLLND- 161

  Fly   243 GDDSVFEALHRCYFVLEQLVKVFCESPQGPEAADVIEVLATALRSEKMTKLFFEQNLFDQVVEQV 307
             :|.|  .:::...::.||.|        .||:     ....:||.:|.         ..:|..:
Zfish   162 -EDQV--VVNKAAVMVHQLSK--------KEAS-----RHAIMRSPQMV---------SAIVRTM 201

  Fly   308 RNHMDLMPLEMRCT-------------IISIFAETAQYEQFLPRMHKAEIADMFLTCLMQNKPAP 359
            :|..|:.  ..|||             :::||....     :|.:.|           |...|..
Zfish   202 QNTNDVE--TARCTSGTLHNLSHHREGLLAIFKSGG-----IPALVK-----------MLGSPVD 248

  Fly   360 AA--YVIQGLHRMSHHPEALRRIVAAYQEGAIRKLVAILMSPDVAIKAREQAGEFLS----RLLV 418
            :.  |.|..||.:..|.|..:  :|....|.::|:||:|...:|         :||:    .|.:
Zfish   249 SVLFYAITTLHNLLLHQEGAK--MAVRLAGGLQKMVALLNKTNV---------KFLAITTDCLQI 302

  Fly   419 AAFRETAAQLQEQDIAVVLTAVIAQGQPTLSIDLI-------LL-----LLTIIESLAQKEEYRT 471
            .|:....::|          .::|.|.|...::::       ||     :|.::...:..:....
Zfish   303 LAYGNQESKL----------IILASGGPQALVNIMRTYTYEKLLWTTSRVLKVLSVCSSNKPAIV 357

  Fly   472 ILGEYSSLTEQLAQLLMRSFAHSILVNNIFRCLCTL--IDEAPVRETLLANY-IVSSMKRALKSL 533
            ..|...:|...|.....|      ||.|   ||.||  :.:|..::|.||.. :...|:..|.:|
Zfish   358 EAGGMQALGLHLTDPSQR------LVQN---CLWTLRNLSDAATKQTSLAEVDVQEGMEGLLGTL 413

  Fly   534 SNLVKTSVTNFI 545
            ..|:.:...|.:
Zfish   414 VQLLGSDDINVV 425

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13326NP_610838.1 EDR1 <759..799 CDD:291079
ctnnb1XP_005157888.1 ARM <151..221 CDD:237987 21/97 (22%)
armadillo repeat 152..177 CDD:293788 6/28 (21%)
armadillo repeat 187..220 CDD:293788 9/43 (21%)
ARM 228..347 CDD:237987 30/155 (19%)
armadillo repeat 229..261 CDD:293788 10/47 (21%)
armadillo repeat 269..305 CDD:293788 10/46 (22%)
armadillo repeat 311..346 CDD:293788 7/44 (16%)
ARM 349..389 CDD:214547 11/48 (23%)
armadillo repeat 353..389 CDD:293788 11/44 (25%)
ARM 407..526 CDD:237987 4/19 (21%)
armadillo repeat 410..435 CDD:293788 4/16 (25%)
armadillo repeat 443..481 CDD:293788
armadillo repeat 490..525 CDD:293788
ARM 492..631 CDD:237987
armadillo repeat 532..590 CDD:293788
armadillo repeat 595..629 CDD:293788
ARM 597..>676 CDD:237987
armadillo repeat 637..670 CDD:293788
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2332
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.