DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13326 and Pkp4

DIOPT Version :9

Sequence 1:NP_610838.1 Gene:CG13326 / 36439 FlyBaseID:FBgn0033794 Length:867 Species:Drosophila melanogaster
Sequence 2:XP_036016888.1 Gene:Pkp4 / 227937 MGIID:109281 Length:1206 Species:Mus musculus


Alignment Length:265 Identity:58/265 - (21%)
Similarity:89/265 - (33%) Gaps:109/265 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly   517 LLANYIVSSMKRALKSLSNLV--------KTSVTNF-----ILQTTRFNEFIDAYIDRGIMEVLL 568
            ||.:.::...|.|..:|.|||        |.::.|.     :|:..|  :.|||.:...:..|| 
Mouse   593 LLDHRVLEVQKNACGALRNLVFGKSTDENKIAMKNVGGIPALLRLLR--KSIDAEVRELVTGVL- 654

  Fly   569 DFQKHAFCISTWGPAIESILSKCPTMKFA-IRNCL-TFTDITAGKDFYVSRRKFEDFR--KFQD- 628
                       |.      ||.|..:|.. ||:.| |.|:.........:...|:|..  |||. 
Mouse   655 -----------WN------LSSCDAVKMTIIRDALSTLTNTVIVPHSGWNNSSFDDDHKIKFQTS 702

  Fly   629 -ILRN--------------------DCSPL-DAVLVM--------NFDRPKPNQNDV-------- 655
             :|||                    .|..| |::|.:        ::| .|..:|.|        
Mouse   703 LVLRNTTGCLRNLSSAGEEARKQMRSCEGLVDSLLYVIHTCVNTSDYD-SKTVENCVCTLRNLSY 766

  Fly   656 ---IAVP---LRCLSTITDLPGDQG---------WGYCKR-----------------PGDNNLPQ 688
               :.||   |..|:.:.||.|.:.         ||..|:                 ||.:..|:
Mouse   767 RLELEVPQARLLGLNELDDLLGKESPSKDSEPSCWGKKKKKKKRTPQEDQWDGVGPIPGLSKSPK 831

  Fly   689 YLEAL 693
            .:|.|
Mouse   832 GVEML 836

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13326NP_610838.1 EDR1 <759..799 CDD:291079
Pkp4XP_036016888.1 Atrophin-1 72..>382 CDD:397323
armadillo repeat 545..570 CDD:293788
Arm 574..613 CDD:395413 6/19 (32%)
armadillo repeat 578..614 CDD:293788 7/20 (35%)
ARM 618..659 CDD:214547 11/60 (18%)
armadillo repeat 622..657 CDD:293788 10/54 (19%)
armadillo repeat 664..715 CDD:293788 14/50 (28%)
armadillo repeat 723..764 CDD:293788 8/41 (20%)
Arm 829..870 CDD:395413 3/8 (38%)
armadillo repeat 840..870 CDD:293788
PLN03200 863..>984 CDD:215629
ARM 880..915 CDD:214547
armadillo repeat 882..914 CDD:293788
armadillo repeat 921..962 CDD:293788
ARM 964..1008 CDD:214547
armadillo repeat 968..1003 CDD:293788
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2332
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.