DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13326 and CTNNB1

DIOPT Version :9

Sequence 1:NP_610838.1 Gene:CG13326 / 36439 FlyBaseID:FBgn0033794 Length:867 Species:Drosophila melanogaster
Sequence 2:NP_001091679.1 Gene:CTNNB1 / 1499 HGNCID:2514 Length:781 Species:Homo sapiens


Alignment Length:349 Identity:76/349 - (21%)
Similarity:122/349 - (34%) Gaps:83/349 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   281 LATALRSEKMTKLFFEQNLFDQVVEQVRNHMDLMPLEMRCTIISIFAETAQYEQFL--PRMHKAE 343
            |||....| :|||..::   ||||.   |...:|       :..:..:.|.....:  |:|..|.
Human   148 LATRAIPE-LTKLLNDE---DQVVV---NKAAVM-------VHQLSKKEASRHAIMRSPQMVSAI 198

  Fly   344 IADMFLTCLMQNKPAPAAYVIQGLHRMSHHPEALRRIVAAYQEGAIRKLVAILMSP--DVAIKA- 405
            :..|..|    |....|......||.:|||.|.|   :|.::.|.|..||.:|.||  .|...| 
Human   199 VRTMQNT----NDVETARCTAGTLHNLSHHREGL---LAIFKSGGIPALVKMLGSPVDSVLFYAI 256

  Fly   406 -------REQAGEFLSRLLVAAFRETAAQLQEQDIA-VVLTA----------------VIAQGQP 446
                   ..|.|..::..|....::..|.|.:.::. :.:|.                ::|.|.|
Human   257 TTLHNLLLHQEGAKMAVRLAGGLQKMVALLNKTNVKFLAITTDCLQILAYGNQESKLIILASGGP 321

  Fly   447 TLSIDLI-------LL-----LLTIIESLAQKEEYRTILGEYSSLTEQLAQLLMRSFAHSILVNN 499
            ...::::       ||     :|.::...:..:......|...:|...|.....|      ||.|
Human   322 QALVNIMRTYTYEKLLWTTSRVLKVLSVCSSNKPAIVEAGGMQALGLHLTDPSQR------LVQN 380

  Fly   500 IFRCLCTLIDEAPVRE----------TLLANYIVSSMKRALKSLSNLVKTSVTN--FILQTTRFN 552
            ....|..|.|.|..:|          .||.:..::.:..|...||||...:..|  .:.|.....
Human   381 CLWTLRNLSDAATKQEGMEGLLGTLVQLLGSDDINVVTCAAGILSNLTCNNYKNKMMVCQVGGIE 445

  Fly   553 EFIDAYIDRGIMEVLLDFQKHAFC 576
            ..:...:..|..|   |..:.|.|
Human   446 ALVRTVLRAGDRE---DITEPAIC 466

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13326NP_610838.1 EDR1 <759..799 CDD:291079
CTNNB1NP_001091679.1 Interaction with VCL. /evidence=ECO:0000250 2..23
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 34..57
SRP1 142..>431 CDD:227396 69/309 (22%)
ARM 1 151..191 11/53 (21%)
armadillo repeat 153..178 CDD:293788 10/38 (26%)
Interaction with BCL9. /evidence=ECO:0000269|PubMed:17052462 156..178 9/34 (26%)
armadillo repeat 188..221 CDD:293788 9/36 (25%)
ARM 2 193..234 14/47 (30%)
armadillo repeat 230..262 CDD:293788 10/31 (32%)
ARM 230..262 CDD:214547 10/31 (32%)
ARM 3 235..276 11/40 (28%)
armadillo repeat 270..306 CDD:293788 4/35 (11%)
ARM 4 277..318 3/40 (8%)
armadillo repeat 312..347 CDD:293788 6/34 (18%)
ARM 5 319..360 5/40 (13%)
ARM 350..390 CDD:214547 9/45 (20%)
armadillo repeat 354..389 CDD:293788 8/40 (20%)
ARM 6 361..389 8/33 (24%)
ARM 7 400..441 8/40 (20%)
armadillo repeat 402..427 CDD:293788 5/24 (21%)
Arm 431..473 CDD:395413 7/39 (18%)
armadillo repeat 435..473 CDD:293788 6/35 (17%)
ARM 8 442..484 5/28 (18%)
armadillo repeat 482..517 CDD:293788
ARM 9 489..530
armadillo repeat 524..582 CDD:293788
ARM 10 531..571
Arm 583..622 CDD:395413
armadillo repeat 587..621 CDD:293788
ARM 11 594..636
armadillo repeat 629..662 CDD:293788
ARM 12 637..666
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 705..781
Interaction with SCRIB. /evidence=ECO:0000250 772..781
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2332
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.