DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3955 and PSCA

DIOPT Version :9

Sequence 1:NP_610837.1 Gene:CG3955 / 36438 FlyBaseID:FBgn0033793 Length:201 Species:Drosophila melanogaster
Sequence 2:NP_005663.2 Gene:PSCA / 8000 HGNCID:9500 Length:114 Species:Homo sapiens


Alignment Length:111 Identity:22/111 - (19%)
Similarity:42/111 - (37%) Gaps:30/111 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 AIERVNKLWCFACHTMDDGEACVDVAVRNDSALMKKCQGEEFICMVKRFSYTTSTENSTSSPKMW 116
            |::....|.|::|......|.|:.  |.|.:.|.::|    :...::.....|            
Human     5 ALQPGTALLCYSCKAQVSNEDCLQ--VENCTQLGEQC----WTARIRAVGLLT------------ 51

  Fly   117 SLDRRCTANC--EPGCIIIGERTKLYSCTSCCEESFCNTGRGAASG 160
            .:.:.|:.||  :.....:|::.     .:||:...||     |||
Human    52 VISKGCSLNCVDDSQDYYVGKKN-----ITCCDTDLCN-----ASG 87

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3955NP_610837.1 None
PSCANP_005663.2 UPAR_LY6 14..84 CDD:306520 15/92 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1536888at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.