DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3955 and Psca

DIOPT Version :9

Sequence 1:NP_610837.1 Gene:CG3955 / 36438 FlyBaseID:FBgn0033793 Length:201 Species:Drosophila melanogaster
Sequence 2:XP_017450598.1 Gene:Psca / 680210 -ID:- Length:125 Species:Rattus norvegicus


Alignment Length:115 Identity:19/115 - (16%)
Similarity:38/115 - (33%) Gaps:33/115 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 RTAAAIERVNK--------LWCFACHTMDDGEACVDVAVRNDSALMKKCQGEEFICMVKRFSYTT 104
            :|.....|:.|        |.|::|........|::|         :.|..::..|...|.    
  Rat     4 KTGRGERRLRKPKPLCGAALQCYSCTAQVSNRDCLNV---------QNCTLDQNSCFTSRV---- 55

  Fly   105 STENSTSSPKMWSLDRRCTANCEPGC--IIIGERTKLYSCTSCCEESFCN 152
                 .:...:..:.:.|::.||...  ..:|::.     .:||....||
  Rat    56 -----RTIGLLTFISKGCSSKCEDDTENYYVGKKN-----ITCCSSDLCN 95



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1536888at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.