DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3955 and Ly6g6e

DIOPT Version :9

Sequence 1:NP_610837.1 Gene:CG3955 / 36438 FlyBaseID:FBgn0033793 Length:201 Species:Drosophila melanogaster
Sequence 2:XP_038954881.1 Gene:Ly6g6e / 406866 RGDID:1303112 Length:183 Species:Rattus norvegicus


Alignment Length:158 Identity:38/158 - (24%)
Similarity:56/158 - (35%) Gaps:70/158 - (44%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 GPSTSLTSGHIHRTAAAIERVNKLWCFACHTMDDGEACVDVAVRNDSALMKKCQGEEFICMVKRF 100
            |.:||.|.|.:|                |:|....:.|..|        :.:|:.:| :|.|   
  Rat    36 GLTTSPTRGRLH----------------CYTCSFAKPCYPV--------LTECREDE-VCGV--- 72

  Fly   101 SYTTSTE----------NSTSS--------PKMWSLDRRCTA----------NCEP--GCIIIGE 135
            |..||..          :||.|        |:::     |.|          .|.|  .|.::|.
  Rat    73 SVGTSGRTGRMALLGGGSSTLSFLPFLPPQPQLF-----CPAEQNKDVIERKGCLPRAQCPLLGH 132

  Fly   136 RT---KLYSCT-SCCEESFCNTGRGAAS 159
            .|   :.|:.. .|||:..|||   |||
  Rat   133 TTYWSRSYTLQHQCCEQDLCNT---AAS 157



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1536888at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.