Sequence 1: | NP_610837.1 | Gene: | CG3955 / 36438 | FlyBaseID: | FBgn0033793 | Length: | 201 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_038954881.1 | Gene: | Ly6g6e / 406866 | RGDID: | 1303112 | Length: | 183 | Species: | Rattus norvegicus |
Alignment Length: | 158 | Identity: | 38/158 - (24%) |
---|---|---|---|
Similarity: | 56/158 - (35%) | Gaps: | 70/158 - (44%) |
- Green bases have known domain annotations that are detailed below.
Fly 36 GPSTSLTSGHIHRTAAAIERVNKLWCFACHTMDDGEACVDVAVRNDSALMKKCQGEEFICMVKRF 100
Fly 101 SYTTSTE----------NSTSS--------PKMWSLDRRCTA----------NCEP--GCIIIGE 135
Fly 136 RT---KLYSCT-SCCEESFCNTGRGAAS 159 |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1536888at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.010 |