powered by:
Protein Alignment CG3955 and F35C12.3
DIOPT Version :9
Sequence 1: | NP_610837.1 |
Gene: | CG3955 / 36438 |
FlyBaseID: | FBgn0033793 |
Length: | 201 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001362164.1 |
Gene: | F35C12.3 / 185275 |
WormBaseID: | WBGene00009408 |
Length: | 264 |
Species: | Caenorhabditis elegans |
Alignment Length: | 30 |
Identity: | 9/30 - (30%) |
Similarity: | 17/30 - (56%) |
Gaps: | 2/30 - (6%) |
- Green bases have known domain annotations that are detailed below.
Fly 170 GTRLFWLAAPFLVNMSLVLYKRH-AGHVLL 198
|.:|:....| :.::||...::| :||..|
Worm 64 GNKLYHKTQP-VPDVSLPGQEKHFSGHAQL 92
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1536888at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.010 |
|
Return to query results.
Submit another query.