DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3955 and LOC101730888

DIOPT Version :9

Sequence 1:NP_610837.1 Gene:CG3955 / 36438 FlyBaseID:FBgn0033793 Length:201 Species:Drosophila melanogaster
Sequence 2:XP_004915863.2 Gene:LOC101730888 / 101730888 -ID:- Length:145 Species:Xenopus tropicalis


Alignment Length:132 Identity:26/132 - (19%)
Similarity:38/132 - (28%) Gaps:55/132 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 AAAIERVNKLWCFACHTMDD--------------GEACVDVAVRNDSALMKKCQGEEFICMVKRF 100
            |..|::...|.|:.|....|              .:||. :.....|.:||.|..:.|.....| 
 Frog    33 ALTIQKGRALQCYTCVGSSDQDCNRQGTQQCPQESDACA-IMRGQSSGVMKSCSYKSFCDRAMR- 95

  Fly   101 SYTTSTENSTSSPKMWSLDRRCTANCEPGCIIIGERTKLYSCTSCCEESFCNT---GRG---AAS 159
                                  ..|..||..:           .||..:.||:   |.|   :||
 Frog    96 ----------------------DGNRAPGMRV-----------QCCFSNNCNSDSKGSGSQLSAS 127

  Fly   160 GI 161
            |:
 Frog   128 GV 129

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3955NP_610837.1 None
LOC101730888XP_004915863.2 LU 42..116 CDD:415855 19/108 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1536888at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.