DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13325 and CG30467

DIOPT Version :9

Sequence 1:NP_001286373.1 Gene:CG13325 / 36437 FlyBaseID:FBgn0033792 Length:697 Species:Drosophila melanogaster
Sequence 2:NP_611044.1 Gene:CG30467 / 36719 FlyBaseID:FBgn0050467 Length:521 Species:Drosophila melanogaster


Alignment Length:167 Identity:36/167 - (21%)
Similarity:65/167 - (38%) Gaps:35/167 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 LGGLESQFSSEDDLLCLNDMKALMTGLGSAEY-----WALKMIDAWGSIPSGLLAGNSYDLGNFD 114
            ||.:.:|....:.|.|  |...|.| |....|     ..::::..:..|.:.:|:|......|:.
  Fly   151 LGNMCAQVECAEILAC--DRYTLET-LFKMTYCMDTAMLIQLMRLFQYIMAHVLSGKEKFAVNWY 212

  Fly   115 ECL----NIRKEIGQERTIQGKYCFLSVSPAKILGIETSIGSFRTATCFPASC---------SAI 166
            .|.    |..:.:|  |.:|     ||||.      |..:.:.:......|||         |.:
  Fly   213 ICFAAFENSAQNLG--RILQ-----LSVSD------ELLVAALKATNAVLASCALVEEENANSTL 264

  Fly   167 NMNAFVDQLMMKLLNVSVPSSAMRI-SEGSCQTSDSE 202
            |:..|.:..::..|...|.|:.:|: .:...:.:|.|
  Fly   265 NLKPFAEVFLVPELCEGVNSAFLRLMRDDQTKLTDEE 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13325NP_001286373.1 NRF 85..198 CDD:214781 25/131 (19%)
Acyl_transf_3 268..648 CDD:280013
OafA 299..654 CDD:224748
CG30467NP_611044.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3700
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.