DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13325 and oac-37

DIOPT Version :9

Sequence 1:NP_001286373.1 Gene:CG13325 / 36437 FlyBaseID:FBgn0033792 Length:697 Species:Drosophila melanogaster
Sequence 2:NP_502710.2 Gene:oac-37 / 186738 WormBaseID:WBGene00010391 Length:659 Species:Caenorhabditis elegans


Alignment Length:414 Identity:79/414 - (19%)
Similarity:142/414 - (34%) Gaps:152/414 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   268 IDCLHGIRCMSLIWVITCHQYSVTLISPHINLFRAATWVEKPFASFILHGFISVDSFLVIGGLLV 332
            |.||.|   :::::|...|.:..|.:                      :|::.||.|.||.|.|:
 Worm     5 IQCLRG---LAILFVFLFHLFPFTFV----------------------NGYLGVDIFFVISGYLM 44

  Fly   333 ALIPLRLMDKTKGKL----NVPMMYLHRLIRIAPLLAMAIVVHMKLMPLISSGPLFVGGYIG--- 390
            |      .:.|..|:    ::...|..|..||.||..:.|.|.:          :||..::|   
 Worm    45 A------RNLTHSKIQNVWDIFKFYYRRFRRILPLYYLFIPVTL----------VFVHLFLGEFW 93

  Fly   391 ---NSACKAGWYWTL---LFVNNY-----------TDAKCLAQSWYLSLDMQLYIISPILLISLY 438
               |.....|.::.:   :|:::.           |.......:|.|.::||.|::.|.::..|.
 Worm    94 WGVNRRYSVGAFFLVSNQVFIHDAHQYFHQYLADGTSINAFIHTWSLGVEMQFYLLVPFIMFGLQ 158

  Fly   439 KWGKKAAAGIFILIILLSACLFATMMVNGYSMMITAASPEAMRDGYYATHTHATPWLIGFLFGYF 503
                      |:...||.  |.|.::.....|                       |.       |
 Worm   159 ----------FLNSPLLK--LIAVILTTFIGM-----------------------WA-------F 181

  Fly   504 LHLNRGKKFQLSWVSVWSGWILCLAMIFTSIFALYPPSKWSDPDASTLAE----------SFYYT 558
            |.:|....|...::.:|.     .:..||::|       |.|.:....|:          |.|..
 Worm   182 LLINAQFSFNFMFLRLWQ-----FSAGFTALF-------WRDFEKCEKAKSTMKIGQEPSSTYQF 234

  Fly   559 LTRVGWALALCWVIFACVQGYGGLANSFLASPL----WQPLSRLSYSVFIWHMFFMEMNARSTRT 619
            |.:...|:....::|.|:          |.:.|    .:||..|:.:    ::|::|.::.....
 Worm   235 LRKDDVAICTIAILFLCI----------LPAKLDEIYLRPLITLTAA----YLFYLEDSSCKLLR 285

  Fly   620 ST---YFSD--YGMMLNFWSTLGF 638
            ||   |..|  |.:.|..|..:.|
 Worm   286 STFLKYMGDISYVLYLVHWPVITF 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13325NP_001286373.1 NRF 85..198 CDD:214781
Acyl_transf_3 268..648 CDD:280013 79/414 (19%)
OafA 299..654 CDD:224748 72/383 (19%)
oac-37NP_502710.2 OafA 4..367 CDD:224748 79/414 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.