DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13325 and oac-10

DIOPT Version :9

Sequence 1:NP_001286373.1 Gene:CG13325 / 36437 FlyBaseID:FBgn0033792 Length:697 Species:Drosophila melanogaster
Sequence 2:NP_494678.3 Gene:oac-10 / 183607 WormBaseID:WBGene00016773 Length:670 Species:Caenorhabditis elegans


Alignment Length:384 Identity:72/384 - (18%)
Similarity:127/384 - (33%) Gaps:133/384 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   269 DCLHGIRCMSLIWVITCHQYSVTLISPHINLFRAATWVEKPFASFILHGFISVDSFLVIGGLLVA 333
            |.|.|:|.:::..|:..|.                      |.....:|:|.||.|.|:.|.|:|
 Worm     4 DDLQGVRGLAIGAVVAFHF----------------------FPESFPNGYIGVDIFFVLSGFLMA 46

  Fly   334 LI----PLRLMDKTKGKLNVPMMYLHRLIRIAPLLAMAIVVHMKLMPLISSGPLFVGGYIGNSAC 394
            :|    |:...       :|...|..|..||.||....:.|.:.|:.:     ||...::..:..
 Worm    47 MIIGTKPITCD-------SVYQFYFRRSKRILPLYLFIVFVGVILVFV-----LFPKTFLSMNMD 99

  Fly   395 KAGWYWTLLFV--------NNYTDAKCLAQ-------SWYLSLDMQLYIISPILLISLYKWGKKA 444
            .|   |:.:|:        :|....|.|.|       :|.|.::||.||::|.:.....:.....
 Worm   100 SA---WSSIFLYHNMAQHSDNNMYFKMLNQAEDIFTHTWSLCVEMQFYILAPAIFFVFSQCTTGT 161

  Fly   445 AAGIFILIIL---LSACLFATMMVNGYSMMITAASPEAMRDGYYATHTHATPWLIGFLFGYFLHL 506
            :..::.:|.:   |...||::..:...|:....                   |  .||.|..:..
 Worm   162 SLALYHIIFIFTSLGTYLFSSDQIAFNSVFCRV-------------------W--QFLIGSAVFF 205

  Fly   507 NRGKKFQ--------------------------LSWVSVWSGWILCLAMIFTSIFALYPPSKWSD 545
            ...||.:                          .|:::.:|  |:....:.|.:..::.|  |..
 Worm   206 YSQKKCEQSCSVNSIEYSKLPENEMEEQIPQENKSYLNRYS--IVLFIALLTIVCMVFSP--WPF 266

  Fly   546 P----------------------DASTLAESFYYTLTRVGWALALC-WVIFACVQGYGG 581
            |                      |.:.|.......|..|.::|.|. |.:|..|:.|.|
 Worm   267 PGDILRVTSTIVTGVLILSGAQSDKNPLRTGALVYLGDVSYSLYLIHWPVFVYVKHYYG 325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13325NP_001286373.1 NRF 85..198 CDD:214781
Acyl_transf_3 268..648 CDD:280013 72/384 (19%)
OafA 299..654 CDD:224748 66/354 (19%)
oac-10NP_494678.3 OafA 1..366 CDD:224748 72/384 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.