DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Drl-2 and KIN1

DIOPT Version :9

Sequence 1:NP_001286371.1 Gene:Drl-2 / 36436 FlyBaseID:FBgn0033791 Length:648 Species:Drosophila melanogaster
Sequence 2:NP_010407.1 Gene:KIN1 / 851700 SGDID:S000002529 Length:1064 Species:Saccharomyces cerevisiae


Alignment Length:398 Identity:78/398 - (19%)
Similarity:152/398 - (38%) Gaps:83/398 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   295 AETIYSKPESICPSRISYYASS---QLTQPCSLSTPKSIRSNGNGN---CTSGSGSLSLFG---- 349
            :.:::::|.::.|:.:.....|   |..|...|..|..|:...|||   .......:.|.|    
Yeast    25 SNSMHTQPSTMAPATLRMMGKSPQQQQQQNTPLMPPADIKYANNGNSHQAEQKERQVELEGKSRE 89

  Fly   350 GIPTGSTITMASHGEKGNQRLRRITSVQP----------GALSYEELVKEGTFGRIYAGKLGESC 404
            ..|..:|.:.:           |::|.|.          |...:.|.|..|:.|::...|...:.
Yeast    90 NAPKPNTTSQS-----------RVSSSQGMPKQFHRKSLGDWEFVETVGAGSMGKVKLAKHRYTN 143

  Fly   405 EALVKTVIDGAS-----------------------------LTQVACLLQDASLLIGVSHQHILA 440
            |.....:::.|:                             :::....:::|||...:.|.|| .
Yeast   144 EVCAVKIVNRATKAFLHKEQMLPPPKNEQDVLERQKKLEKEISRDKRTIREASLGQILYHPHI-C 207

  Fly   441 PLLANTELPGPPEIAYPHPSKGNLKMYLQKSRESSTALSTRQLVEFGLHITKGLAYLHSLGIVHK 505
            .|.....|.....:.:.:.|.|.|..|:.:    ..::...|..:|...|...|.|||:..|||:
Yeast   208 RLFEMCTLSNHFYMLFEYVSGGQLLDYIIQ----HGSIREHQARKFARGIASALIYLHANNIVHR 268

  Fly   506 DIATRNCYLDEESYVKICDSALSRDLFPDDYDCLGDNENR------PLKWLSLESLQKRVY-ATQ 563
            |:...|..:.:.|.:||.|..||.         :.|:..:      .|.:.:.|.|:...| ..:
Yeast   269 DLKIENIMISDSSEIKIIDFGLSN---------IYDSRKQLHTFCGSLYFAAPELLKANPYTGPE 324

  Fly   564 GDVWALGVTYWELVTLAQMPHEEVDIFELTNYLAAGFRLEQPVNCPDEFFTVMNCCWHCEAKQRP 628
            .|||:.||..:.|| ..::|.::.:...|...:..| ::|.|.:...|..::::.....:.|:|.
Yeast   325 VDVWSFGVVLFVLV-CGKVPFDDENSSVLHEKIKQG-KVEYPQHLSIEVISLLSKMLVVDPKRRA 387

  Fly   629 TPSQLLSY 636
            |..|::.:
Yeast   388 TLKQVVEH 395

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Drl-2NP_001286371.1 WIF 37..156 CDD:280237
PTK_Ryk 373..644 CDD:270639 62/310 (20%)
STYKc 389..637 CDD:214568 57/284 (20%)
KIN1NP_010407.1 STKc_Kin1_2 118..398 CDD:270979 60/294 (20%)
MARK_C_like 890..1062 CDD:213377
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.