DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Drl-2 and Ret

DIOPT Version :9

Sequence 1:NP_001286371.1 Gene:Drl-2 / 36436 FlyBaseID:FBgn0033791 Length:648 Species:Drosophila melanogaster
Sequence 2:NP_477044.1 Gene:Ret / 43875 FlyBaseID:FBgn0011829 Length:1235 Species:Drosophila melanogaster


Alignment Length:284 Identity:86/284 - (30%)
Similarity:141/284 - (49%) Gaps:17/284 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   381 LSYEELVKEGTFGRIYAGKLGESC------EALVKTVIDGASLTQVACLLQDASLLIGVSHQHIL 439
            |..:.::.||.||::..|...|..      ...||.:..|::..:...||.:..||..|||.:::
  Fly   771 LQLDTVLGEGEFGQVLKGFATEIAGLPGITTVAVKMLKKGSNSVEYMALLSEFQLLQEVSHPNVI 835

  Fly   440 APLLANTELPGPPEIAYPHPSKGNLKMYLQKSRESSTA----------LSTRQLVEFGLHITKGL 494
            ..|.|.|.... |.:...:...|:|:.||:.||:...|          ::.:.::.|...|.||:
  Fly   836 KLLGACTSSEA-PLLIIEYARYGSLRSYLRLSRKIECAGVDFADGVEPVNVKMVLTFAWQICKGM 899

  Fly   495 AYLHSLGIVHKDIATRNCYLDEESYVKICDSALSRDLFPDDYDCLGDNENRPLKWLSLESLQKRV 559
            |||..|.:||:|:|.||..|.:....||.|..|:||::.||.......:..|:||::.|||...|
  Fly   900 AYLSELKLVHRDLAARNVLLADGKICKISDFGLTRDVYEDDAYLKRSRDRVPVKWMAPESLADHV 964

  Fly   560 YATQGDVWALGVTYWELVTLAQMPHEEVDIFELTNYLAAGFRLEQPVNCPDEFFTVMNCCWHCEA 624
            |.::.|||:.||..|||:||...|:..:....|.:.|..|:|:::|.||.:..::::..||..|.
  Fly   965 YTSKSDVWSFGVLCWELITLGASPYPGIAPQNLWSLLKTGYRMDRPENCSEAVYSIVRTCWADEP 1029

  Fly   625 KQRPTPSQLLSYLQDFHADLGMYI 648
            ..||:...|.|..:....:...||
  Fly  1030 NGRPSFKFLASEFEKLLGNNAKYI 1053

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Drl-2NP_001286371.1 WIF 37..156 CDD:280237
PTK_Ryk 373..644 CDD:270639 84/278 (30%)
STYKc 389..637 CDD:214568 83/263 (32%)
RetNP_477044.1 PKc_like 770..1049 CDD:304357 84/278 (30%)
TyrKc 771..1042 CDD:197581 84/271 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24416
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.