DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Drl-2 and Tie

DIOPT Version :9

Sequence 1:NP_001286371.1 Gene:Drl-2 / 36436 FlyBaseID:FBgn0033791 Length:648 Species:Drosophila melanogaster
Sequence 2:NP_523928.1 Gene:Tie / 38559 FlyBaseID:FBgn0014073 Length:1233 Species:Drosophila melanogaster


Alignment Length:613 Identity:129/613 - (21%)
Similarity:212/613 - (34%) Gaps:203/613 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   163 GISPEPNQSPAPAHAPSQGPALLSAAACALGLVLAVGLVASMMYVRARKQLRQDSLHTSFTTAAY 227
            |::|.....  |:|.....|.:|...        .:..:.|.::.|.    ...|..||.||.| 
  Fly   631 GVTPRTQTQ--PSHTTDSSPKILRTT--------VLTSIRSTVHPRP----TSTSTTTSTTTTA- 680

  Fly   228 GSHQNVFIRLDPLGRPPSATGS----YATI--ASLNKYPAD-------SKKSCSIFDRFRSSPTP 279
                           ||:.|..    |..|  :|.:..|||       :::..::..|..:..|.
  Fly   681 ---------------PPAVTAPSNEVYIGIVESSSSASPADISSTVIANERDLNMEMRRMNLVTL 730

  Fly   280 TPYATALLPM-----------------NLEQTAETIYSKPESICP-------------------- 307
            ...|..::|:                 ...:..:...:..:.|.|                    
  Fly   731 VLVAVGVIPLAAIILYLVRNFVIRRRAKQSEVFDVCITDQQPISPVKKVDSKYQVDDDEDEVDHQ 795

  Fly   308 --SRISYYASSQLTQ--------PCSLSTPKSIRSNGNGNCTSGSGSLSLFGGIPTGSTITMASH 362
              ..:.::.:.|..|        |.|.::.:....|..||....:...|.|...           
  Fly   796 HHQHMQHHQNHQNHQNHQHHQAMPMSQASQRDANHNRYGNNDDKTSLASEFHDF----------- 849

  Fly   363 GEKGNQRLRRITSVQPGALSYEELVKEGTFGRIY-------AGKLGESCEALVKTVIDGASLTQV 420
             |:.|.||:             .|:.||.||:::       :|..|.:....|||:  .|...||
  Fly   850 -ERSNIRLK-------------SLLGEGNFGQVWKAEADDLSGHFGATRIVAVKTI--RACSAQV 898

  Fly   421 ACLLQDASLL--IGVSHQHILAPLLANTELPGPPEIAYPHPSKGNLKMYLQKSR----------- 472
            : |..:|:::  :| |||:::..|.|..| ..|..:...:..:|.|...|:.:|           
  Fly   899 S-LKDEANIMRKLG-SHQNVVTLLGACVE-SEPHMLIMEYAMRGRLLSLLRAARSATNILPASVP 960

  Fly   473 --ESSTALSTRQLVEFGLHITKGLAYLHSLGIVHKDIATRNCYLDEESYVKICDSALSRDL---- 531
              .|...||.|.|..|.|.|..|:.|:....|||:|:|.||..||.....||||..:|.||    
  Fly   961 GGRSLAPLSPRTLAGFALDIACGMEYIAGRRIVHRDLAARNVLLDHNGMCKICDFGMSIDLDAER 1025

  Fly   532 --------------------FPDDY-------------------------------------DCL 539
                                |..|:                                     |.:
  Fly  1026 MRKEQEKNAANDLMRHNAHKFKFDFGSRYILQHWQHTFGQGQGQGHCSKDQPHGEKKSHHGHDTI 1090

  Fly   540 GDNENRPLKWLSLESLQKRVYATQGDVWALGVTYWELVTLAQMPHEEVDIFELTNYLAAGFRLEQ 604
            |.....|::|::.||||..::.|:.|:||.|:..||:.||...|:.::...|:...:..|.|.:.
  Fly  1091 GKRHALPIRWMAPESLQYHMFTTETDIWAFGIVLWEIATLGSTPYSQLTGREVIRRVPQGLRPDL 1155

  Fly   605 PVNCPDEFFTVMNCCWHCEAKQRPTPSQ 632
            |.....||:.:|:.|||.|...||:.:|
  Fly  1156 PKESRHEFYNLMSRCWHKEPHMRPSFAQ 1183

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Drl-2NP_001286371.1 WIF 37..156 CDD:280237
PTK_Ryk 373..644 CDD:270639 87/343 (25%)
STYKc 389..637 CDD:214568 86/327 (26%)
TieNP_523928.1 TyrKc 854..1183 CDD:197581 88/346 (25%)
PTKc 860..1187 CDD:270623 86/329 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24416
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.