DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Drl-2 and sev

DIOPT Version :9

Sequence 1:NP_001286371.1 Gene:Drl-2 / 36436 FlyBaseID:FBgn0033791 Length:648 Species:Drosophila melanogaster
Sequence 2:NP_511114.2 Gene:sev / 32039 FlyBaseID:FBgn0003366 Length:2554 Species:Drosophila melanogaster


Alignment Length:276 Identity:88/276 - (31%)
Similarity:141/276 - (51%) Gaps:26/276 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   390 GTFGRIYAGKL-----GESCEALVKTVIDGASLTQVACLLQDASLLIGVSHQHI--LAPLLANTE 447
            |.||.:|.|:|     .|.....:|::..|||  :.|.|||:|.|:....|::|  |..:..:||
  Fly  2218 GAFGEVYEGQLKTEDSEEPQRVAIKSLRKGAS--EFAELLQEAQLMSNFKHENIVCLVGICFDTE 2280

  Fly   448 LPGPPEIAYPHPSKGNLKMYLQKSRESST-------ALSTRQLVEFGLHITKGLAYLHSLGIVHK 505
               ...:...|...|:|..||:.:|.:||       .||..:|:...:.:..|.:||..:..||:
  Fly  2281 ---SISLIMEHMEAGDLLSYLRAARATSTQEPQPTAGLSLSELLAMCIDVANGCSYLEDMHFVHR 2342

  Fly   506 DIATRNCYL-------DEESYVKICDSALSRDLFPDDYDCLGDNENRPLKWLSLESLQKRVYATQ 563
            |:|.|||.:       |....|||.|..|:||::..||.........|::|:|.|||...::.||
  Fly  2343 DLACRNCLVTESTGSTDRRRTVKIGDFGLARDIYKSDYYRKEGEGLLPVRWMSPESLVDGLFTTQ 2407

  Fly   564 GDVWALGVTYWELVTLAQMPHEEVDIFELTNYLAAGFRLEQPVNCPDEFFTVMNCCWHCEAKQRP 628
            .||||.||..||::||.|.|:...:.||:..::..|.||:||..|.::.::::..||..:..:||
  Fly  2408 SDVWAFGVLCWEILTLGQQPYAARNNFEVLAHVKEGGRLQQPPMCTEKLYSLLLLCWRTDPWERP 2472

  Fly   629 TPSQLLSYLQDFHADL 644
            :..:..:.|.....||
  Fly  2473 SFRRCYNTLHAISTDL 2488

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Drl-2NP_001286371.1 WIF 37..156 CDD:280237
PTK_Ryk 373..644 CDD:270639 86/274 (31%)
STYKc 389..637 CDD:214568 85/267 (32%)
sevNP_511114.2 fn3 439..520 CDD:278470
FN3 826..921 CDD:238020
LY 993..1026 CDD:214531
FN3 1292..1374 CDD:214495
FN3 1799..1897 CDD:238020
FN3 1993..2111 CDD:238020
Pkinase_Tyr 2209..2481 CDD:285015 85/267 (32%)
PTKc_c-ros 2213..2483 CDD:270640 86/269 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24416
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.