DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Drl-2 and ERBB4

DIOPT Version :9

Sequence 1:NP_001286371.1 Gene:Drl-2 / 36436 FlyBaseID:FBgn0033791 Length:648 Species:Drosophila melanogaster
Sequence 2:XP_016859066.1 Gene:ERBB4 / 2066 HGNCID:3432 Length:1349 Species:Homo sapiens


Alignment Length:303 Identity:84/303 - (27%)
Similarity:144/303 - (47%) Gaps:36/303 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   363 GEKGNQRLRRITSVQPGALSYEELVKEGTFGRIYAG---------KLGESCEALVKTVIDGASLT 418
            |...||...||  ::...|...:::..|.||.:|.|         |:..:.:.|.:|....|::.
Human   743 GTAPNQAQLRI--LKETELKRVKVLGSGAFGTVYKGIWVPEGETVKIPVAIKILNETTGPKANVE 805

  Fly   419 QVACLLQDASLLIGVSHQHI-------LAPLL-ANTELPGPPEIAYPHPSKGNLKMYLQKSRESS 475
                .:.:|.::..:.|.|:       |:|.: ..|:|       .||   |.|..|:.:.::: 
Human   806 ----FMDEALIMASMDHPHLVRLLGVCLSPTIQLVTQL-------MPH---GCLLEYVHEHKDN- 855

  Fly   476 TALSTRQLVEFGLHITKGLAYLHSLGIVHKDIATRNCYLDEESYVKICDSALSRDLFPDDYDCLG 540
              :.::.|:.:.:.|.||:.||....:||:|:|.||..:...::|||.|..|:|.|..|:.:...
Human   856 --IGSQLLLNWCVQIAKGMMYLEERRLVHRDLAARNVLVKSPNHVKITDFGLARLLEGDEKEYNA 918

  Fly   541 DNENRPLKWLSLESLQKRVYATQGDVWALGVTYWELVTLAQMPHEEVDIFELTNYLAAGFRLEQP 605
            |....|:||::||.:..|.:..|.|||:.|||.|||:|....|::.:...|:.:.|..|.||.||
Human   919 DGGKMPIKWMALECIHYRKFTHQSDVWSYGVTIWELMTFGGKPYDGIPTREIPDLLEKGERLPQP 983

  Fly   606 VNCPDEFFTVMNCCWHCEAKQRPTPSQLLSYLQDFHADLGMYI 648
            ..|..:.:.||..||..:|..||...:|.:.......|...|:
Human   984 PICTIDVYMVMVKCWMIDADSRPKFKELAAEFSRMARDPQRYL 1026

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Drl-2NP_001286371.1 WIF 37..156 CDD:280237
PTK_Ryk 373..644 CDD:270639 78/287 (27%)
STYKc 389..637 CDD:214568 76/264 (29%)
ERBB4XP_016859066.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1025
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.