DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Drl-2 and let-23

DIOPT Version :9

Sequence 1:NP_001286371.1 Gene:Drl-2 / 36436 FlyBaseID:FBgn0033791 Length:648 Species:Drosophila melanogaster
Sequence 2:NP_001300607.1 Gene:let-23 / 174462 WormBaseID:WBGene00002299 Length:1335 Species:Caenorhabditis elegans


Alignment Length:256 Identity:74/256 - (28%)
Similarity:127/256 - (49%) Gaps:10/256 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   390 GTFGRIYAG----KLGESCEALVKTVIDGASLTQVACLLQDASLLIGVSHQHILAPLLANTELPG 450
            |.||.::||    |..::.:..|...:.....:|...:|::|:.:..:.|.::|..:.......|
 Worm   906 GAFGTVFAGIYYPKRAKNVKIPVAIKVFQTDQSQTDEMLEEATNMFRLRHDNLLKIIGFCMHDDG 970

  Fly   451 PPEIAYPHPSKGNLKMYLQKSRESSTALSTRQLVEFGLHITKGLAYLHSLGIVHKDIATRNCYLD 515
            ...:....| .|||:.:|:..:|:   |..|:.|.:...|..|:.||....:||:|:||||..:.
 Worm   971 LKIVTIYRP-LGNLQNFLKLHKEN---LGAREQVLYCYQIASGMQYLEKQRVVHRDLATRNVLVK 1031

  Fly   516 EESYVKICDSALSRDLFPDDYDCLGDNENR-PLKWLSLESLQKRVYATQGDVWALGVTYWELVTL 579
            :.::|:|.|..||: :...|.|.:.....: .:|||::|...|..|....||||.|||.||::|.
 Worm  1032 KFNHVEITDFGLSK-ILKHDADSITIKSGKVAIKWLAIEIFSKHCYTHASDVWAFGVTCWEIITF 1095

  Fly   580 AQMPHEEVDIFELTNYLAAGFRLEQPVNCPDEFFTVMNCCWHCEAKQRPTPSQLLSYLQDF 640
            .|.|::.:....:.|:|..|.||.||.||..:.:..:..||..:.|.||....|....::|
 Worm  1096 GQSPYQGMSTDSIHNFLKDGNRLSQPPNCSQDLYQELLRCWMADPKSRPGFEILYERFKEF 1156

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Drl-2NP_001286371.1 WIF 37..156 CDD:280237
PTK_Ryk 373..644 CDD:270639 74/256 (29%)
STYKc 389..637 CDD:214568 73/251 (29%)
let-23NP_001300607.1 Recep_L_domain 77..205 CDD:279382
Furin-like 229..378 CDD:279142
FU 274..>308 CDD:238021
Recep_L_domain 396..503 CDD:279382
GF_recep_IV 531..652 CDD:291509
FU 532..580 CDD:238021
FU 578..625 CDD:214589
FU 759..806 CDD:214589
PKc_like 885..1164 CDD:304357 74/256 (29%)
TyrKc 898..1153 CDD:197581 73/251 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.