DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Drl-2 and Erbb4

DIOPT Version :9

Sequence 1:NP_001286371.1 Gene:Drl-2 / 36436 FlyBaseID:FBgn0033791 Length:648 Species:Drosophila melanogaster
Sequence 2:XP_006495755.1 Gene:Erbb4 / 13869 MGIID:104771 Length:1308 Species:Mus musculus


Alignment Length:303 Identity:84/303 - (27%)
Similarity:144/303 - (47%) Gaps:36/303 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   363 GEKGNQRLRRITSVQPGALSYEELVKEGTFGRIYAG---------KLGESCEALVKTVIDGASLT 418
            |...||...||  ::...|...:::..|.||.:|.|         |:..:.:.|.:|....|::.
Mouse   702 GTAPNQAQLRI--LKETELKRVKVLGSGAFGTVYKGIWVPEGETVKIPVAIKILNETTGPKANVE 764

  Fly   419 QVACLLQDASLLIGVSHQHI-------LAPLL-ANTELPGPPEIAYPHPSKGNLKMYLQKSRESS 475
                .:.:|.::..:.|.|:       |:|.: ..|:|       .||   |.|..|:.:.::: 
Mouse   765 ----FMDEALIMASMDHPHLVRLLGVCLSPTIQLVTQL-------MPH---GCLLDYVHEHKDN- 814

  Fly   476 TALSTRQLVEFGLHITKGLAYLHSLGIVHKDIATRNCYLDEESYVKICDSALSRDLFPDDYDCLG 540
              :.::.|:.:.:.|.||:.||....:||:|:|.||..:...::|||.|..|:|.|..|:.:...
Mouse   815 --IGSQLLLNWCVQIAKGMMYLEERRLVHRDLAARNVLVKSPNHVKITDFGLARLLEGDEKEYNA 877

  Fly   541 DNENRPLKWLSLESLQKRVYATQGDVWALGVTYWELVTLAQMPHEEVDIFELTNYLAAGFRLEQP 605
            |....|:||::||.:..|.:..|.|||:.|||.|||:|....|::.:...|:.:.|..|.||.||
Mouse   878 DGGKMPIKWMALECIHYRKFTHQSDVWSYGVTIWELMTFGGKPYDGIPTREIPDLLEKGERLPQP 942

  Fly   606 VNCPDEFFTVMNCCWHCEAKQRPTPSQLLSYLQDFHADLGMYI 648
            ..|..:.:.||..||..:|..||...:|.:.......|...|:
Mouse   943 PICTIDVYMVMVKCWMIDADSRPKFKELAAEFSRMARDPQRYL 985

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Drl-2NP_001286371.1 WIF 37..156 CDD:280237
PTK_Ryk 373..644 CDD:270639 78/287 (27%)
STYKc 389..637 CDD:214568 76/264 (29%)
Erbb4XP_006495755.1 Recep_L_domain 55..165 CDD:366426
Furin-like 186..334 CDD:366287
Recep_L_domain 358..475 CDD:366426
GF_recep_IV 502..634 CDD:373332
TM_ErbB4 642..685 CDD:213053
PTKc_HER4 710..1012 CDD:173655 81/295 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1025
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.