DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13324 and CG15043

DIOPT Version :10

Sequence 1:NP_610833.1 Gene:CG13324 / 36434 FlyBaseID:FBgn0033789 Length:112 Species:Drosophila melanogaster
Sequence 2:NP_573300.1 Gene:CG15043 / 32835 FlyBaseID:FBgn0030929 Length:163 Species:Drosophila melanogaster


Alignment Length:157 Identity:24/157 - (15%)
Similarity:46/157 - (29%) Gaps:82/157 - (52%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 VVLAVILGC-----------------------HAYSATW-------------------------- 24
            ::|:.:|||                       |.::|.:                          
  Fly     7 ILLSALLGCLVSGGAAGTIRVDTTGIQVVDNIHVFAAQYPGLQIQQMEKEIVPAKARVGSQTVRY 71

  Fly    25 --GRRVNNDFLLSRTREVRNPIKNNYWNVNVNYPNGFYNISAVIVYDNFKNNSGASPS------- 80
              |.|:..|.|:::|       .|.|     .:|.. .::|..:.|.  :|..||:.|       
  Fly    72 NMGARIPGDELVAQT-------ANTY-----EFPRA-QDVSLQLTYP--ENGKGATVSYVELLCT 121

  Fly    81 ---------LYSGGPGYRFATVNLRGQ 98
                     :.:||.|....::.|..:
  Fly   122 QDTNEGTAYVVAGGIGQSLISIVLEAK 148

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13324NP_610833.1 MBF2 24..111 CDD:464913 18/119 (15%)
CG15043NP_573300.1 MBF2 74..161 CDD:464913 18/90 (20%)

Return to query results.
Submit another query.