DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13323 and CG31789

DIOPT Version :10

Sequence 1:NP_610832.1 Gene:CG13323 / 36433 FlyBaseID:FBgn0033788 Length:112 Species:Drosophila melanogaster
Sequence 2:NP_724118.1 Gene:CG31789 / 318943 FlyBaseID:FBgn0051789 Length:117 Species:Drosophila melanogaster


Alignment Length:114 Identity:37/114 - (32%)
Similarity:61/114 - (53%) Gaps:7/114 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MRLLLILSVVLAVILGCHAYGATWGRRNNNDYLLSRTTEVRNPIKNNYWNVNVNYP-AGFYN--- 61
            ::..|:.|.:||:   ..|..|:||.:.::..|:|..........|.|.:..:::| ||..|   
  Fly     4 LQFALVFSAILAI---AFAANASWGAKLSSSKLVSTQNVTIYKKANQYVSSLISFPLAGQSNTKT 65

  Fly    62 ISAVIVYDNFKNNSGASPSLYSGGPGYRFATVNLRGQVNRGINSTVEIW 110
            |..:.:.|.|.|:||...:|:|||||:..|.||:..|.::|||.|.:.|
  Fly    66 IRYISITDRFTNSSGPYSTLWSGGPGFINAQVNVTSQFSQGINVTAQFW 114

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13323NP_610832.1 MBF2 24..111 CDD:464913 31/91 (34%)
CG31789NP_724118.1 MBF2 24..114 CDD:464913 30/89 (34%)

Return to query results.
Submit another query.