DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Su(z)2 and PCGF1

DIOPT Version :9

Sequence 1:NP_001260933.1 Gene:Su(z)2 / 36432 FlyBaseID:FBgn0265623 Length:1396 Species:Drosophila melanogaster
Sequence 2:NP_116062.2 Gene:PCGF1 / 84759 HGNCID:17615 Length:259 Species:Homo sapiens


Alignment Length:256 Identity:71/256 - (27%)
Similarity:120/256 - (46%) Gaps:52/256 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 NTMESNAAMDAASPASRD------VRQFHDLITCRLCRGYMIDPTTVDYCYHTYCRSCILKHLLR 66
            |.::|...||   |...:      ::..::.|.|.||.||.:|.||:..|.||:|:|||:|:|..
Human    17 NQLQSVYKMD---PLRNEEEVRVKIKDLNEHIVCCLCAGYFVDATTITECLHTFCKSCIVKYLQT 78

  Fly    67 AVYCPECKASGGKEINE----LNLKSDDTLRSLIYKLVPGLYQRECKELADFKEQH--DLVDEQT 125
            :.|||.|..    :|:|    ||||.|..::.::|||||||...|.|.:.:|.:..  |.|.:.|
Human    79 SKYCPMCNI----KIHETQPLLNLKLDRVMQDIVYKLVPGLQDSEEKRIREFYQSRGLDRVTQPT 139

  Fly   126 TDEP-----------------EFFTTTELISLSLEYHPAMLHQCGPGE-----VPPTIYLQCAAG 168
            .:||                 .::...|.::|.||       :...|:     |....|::|:..
Human   140 GEEPALSNLGLPFSSFDHSKAHYYRYDEQLNLCLE-------RLSSGKDKNKSVLQNKYVRCSVR 197

  Fly   169 LPVELLKRFLCSKYNIETDNGLVEVEVTYKDEVLPTNFTLMDVAYCYNWSRESPMAFCYRI 229
            ..|..|:|.||.:..:...:    |::.:.:||||.:.|:..:.....:.:.||:...|.:
Human   198 AEVRHLRRVLCHRLMLNPQH----VQLLFDNEVLPDHMTMKQIWLSRWFGKPSPLLLQYSV 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Su(z)2NP_001260933.1 zf-C3HC4 35..73 CDD:278524 20/37 (54%)
RAWUL 143..228 CDD:292824 18/89 (20%)
PCGF1NP_116062.2 RING-HC_PCGF1 44..86 CDD:319647 21/41 (51%)
RING-HC finger (C3HC4-type) 47..85 CDD:319647 20/37 (54%)
Required for repressor activity 86..247 41/175 (23%)
Required for the interaction with the KDM2B-SKP1 heterodimeric complex. /evidence=ECO:0000269|PubMed:27568929 150..255 22/116 (19%)
RAWUL_PCGF1 166..253 CDD:340601 21/97 (22%)
RING-finger and WD40-associated ubiquitin-like domain (RAWUL), sufficient for interaction with BCOR and BCORL1. /evidence=ECO:0000269|PubMed:23523425, ECO:0000269|PubMed:27568929 167..255 22/99 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165157887
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2660
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1203951at2759
OrthoFinder 1 1.000 - - FOG0000290
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.750

Return to query results.
Submit another query.