DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Su(z)2 and PCGF5

DIOPT Version :9

Sequence 1:NP_001260933.1 Gene:Su(z)2 / 36432 FlyBaseID:FBgn0265623 Length:1396 Species:Drosophila melanogaster
Sequence 2:NP_001243478.1 Gene:PCGF5 / 84333 HGNCID:28264 Length:256 Species:Homo sapiens


Alignment Length:251 Identity:67/251 - (26%)
Similarity:119/251 - (47%) Gaps:57/251 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 VRQFHDLITCRLCRGYMIDPTTVDYCYHTYCRSCILKHLLRAVYCPECKASGGKEINELN----L 86
            |:.|:..|||.:|:||:|.||||..|.||:|::||::|...:..||.|    |.:::|.|    |
Human     9 VKDFNPYITCYICKGYLIKPTTVTECLHTFCKTCIVQHFEDSNDCPRC----GNQVHETNPLEML 69

  Fly    87 KSDDTLRSLIYKLVPGLYQRECKELADF---------------KEQHDLVDE---QTTDEPEFFT 133
            :.|:||..:|:||||||.::|.:..::|               |.....|||   :..|:.::..
Human    70 RLDNTLEEIIFKLVPGLREQELERESEFWKKNKPQENGQDDTSKADKPKVDEEGDENEDDKDYHR 134

  Fly   134 TTELISLSLEYHPAMLH---QCGPGEVPPTI--YLQCAAGLPVELLKRFLCSKYNIETDNGLVEV 193
            :...|::.|:    .|.   |.|...|...:  :::|:..:.|..:|:||..|..:.:.   .|:
Human   135 SDPQIAICLD----CLRNNGQSGDNVVKGLMKKFIRCSTRVTVGTIKKFLSLKLKLPSS---YEL 192

  Fly   194 EVTYKDEVLPTNFTLMDVAYCYNW------------------SRESPMAFCYRILL 231
            :|....|::..:.| |:..|...|                  |::.|:...|.::|
Human   193 DVLCNGEIMGKDHT-MEFIYMTRWRLRGENFRCLNCSASQVCSQDGPLYQSYPMVL 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Su(z)2NP_001260933.1 zf-C3HC4 35..73 CDD:278524 18/37 (49%)
RAWUL 143..228 CDD:292824 19/107 (18%)
PCGF5NP_001243478.1 rad18 8..>116 CDD:273165 40/110 (36%)
RING-HC_PCGF5 16..57 CDD:319651 21/44 (48%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 94..133 6/38 (16%)
RAWUL_PCGF5 136..256 CDD:340604 23/120 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165157889
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2660
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1203951at2759
OrthoFinder 1 1.000 - - FOG0000290
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.750

Return to query results.
Submit another query.