DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Su(z)2 and Pcgf5

DIOPT Version :9

Sequence 1:NP_001260933.1 Gene:Su(z)2 / 36432 FlyBaseID:FBgn0265623 Length:1396 Species:Drosophila melanogaster
Sequence 2:XP_017445196.1 Gene:Pcgf5 / 681178 RGDID:1583513 Length:253 Species:Rattus norvegicus


Alignment Length:219 Identity:61/219 - (27%)
Similarity:109/219 - (49%) Gaps:39/219 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 VRQFHDLITCRLCRGYMIDPTTVDYCYHTYCRSCILKHLLRAVYCPECKASGGKEINELN----L 86
            |:.|:..|||.:|:||:|.||||..|.||:|::||::|...:..||.|    |.:::|.|    |
  Rat     9 VKDFNPYITCYICKGYLIKPTTVTECLHTFCKTCIVQHFEDSNDCPRC----GNQVHETNPLEML 69

  Fly    87 KSDDTLRSLIYKLVPGLYQRECKELADF------------------KEQHDLVDEQTTDEPEFFT 133
            :.|:||..:|:||||||.::|.:...:|                  |.:.|...::..|:.::..
  Rat    70 RLDNTLEEIIFKLVPGLREQELQRELEFWKKNKPQENGQDEVSKVDKSKADEEGDENQDDKDYHR 134

  Fly   134 TTELISLSLE---YHPAMLHQCGPGEVPPTI--YLQCAAGLPVELLKRFLCSKYNIETDNGLVEV 193
            :...|::.|:   .|    .|.|...|...:  :::|:..:.|..:|:||..|..:.:.   .|:
  Rat   135 SDPQIAICLDCLRNH----GQSGDNVVKGLMKKFIRCSTRVTVGTIKKFLSLKLKLPSS---YEL 192

  Fly   194 EVTYKDEVLPTNFTLMDVAYCYNW 217
            :|....|::..:.| |:..|...|
  Rat   193 DVLCNGEIMGKDHT-MEFIYMTRW 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Su(z)2NP_001260933.1 zf-C3HC4 35..73 CDD:278524 18/37 (49%)
RAWUL 143..228 CDD:292824 17/80 (21%)
Pcgf5XP_017445196.1 zf-C3HC4 18..56 CDD:278524 18/37 (49%)
RAWUL 154..216 CDD:292824 14/66 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166351887
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2660
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1203951at2759
OrthoFinder 1 1.000 - - FOG0000290
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.750

Return to query results.
Submit another query.