DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Su(z)2 and RING1

DIOPT Version :9

Sequence 1:	NP_001260933.1	Gene:	Su(z)2 / 36432	FlyBaseID:	FBgn0265623	Length:	1396	Species:	Drosophila melanogaster
Sequence 2:	NP_002922.2	Gene:	RING1 / 6015	HGNCID:	10018	Length:	406	Species:	Homo sapiens

Alignment Length:	115	Identity:	31/115 - (26%)
Similarity:	49/115 - (42%)	Gaps:	14/115 - (12%)

- Green bases have known domain annotations that are detailed below.

  Fly     1 MHLQNTHNTMESNAAMD----AASPASRDVRQFHDLITCRLCRGYMIDPTTVDYCYHTYCRSCIL 61
            :.|...|.|.: .|.||    |.||     |..|..:.|.:|...:.:..|...|.|.:|..||:
Human    16 LSLYELHRTPQ-EAIMDGTEIAVSP-----RSLHSELMCPICLDMLKNTMTTKECLHRFCSDCIV 74

  Fly    62 KHLLRA-VYCPECKASGGKEINELNLKSDDTLRSLIYKLVPGLYQRECKE 110
            ..|... ..||.|:.   |.:::.:|:.|....:||.|:.|...:.|..:
Human    75 TALRSGNKECPTCRK---KLVSKRSLRPDPNFDALISKIYPSREEYEAHQ 121

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Su(z)2	NP_001260933.1	zf-C3HC4	35..73	CDD:278524	11/38 (29%)
Su(z)2	NP_001260933.1	RAWUL	143..228	CDD:292824
RING1	NP_002922.2	Necessary for transcriptional repression. /evidence=ECO:0000250	30..234		27/100 (27%)
		RING-HC_RING1	47..90	CDD:319653	12/45 (27%)
		RING-HC finger (C3HC4-type)	48..87	CDD:319653	11/38 (29%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	148..263
		Nuclear localization signal. /evidence=ECO:0000255	201..204
		Necessary for interaction with CBX2. /evidence=ECO:0000250	230..406
		RAWUL	282..400	CDD:318447
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	309..354
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	1	0.930	-	-		C165157897
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	2	1.840