DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Su(z)2 and pcgf5a

DIOPT Version :9

Sequence 1:NP_001260933.1 Gene:Su(z)2 / 36432 FlyBaseID:FBgn0265623 Length:1396 Species:Drosophila melanogaster
Sequence 2:NP_001122184.1 Gene:pcgf5a / 562327 ZFINID:ZDB-GENE-080723-33 Length:234 Species:Danio rerio


Alignment Length:233 Identity:72/233 - (30%)
Similarity:113/233 - (48%) Gaps:43/233 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 VRQFHDLITCRLCRGYMIDPTTVDYCYHTYCRSCILKHLLRAVYCPECKASGGKEINELN----L 86
            ||.|:..|||.:||||:|.||.|..|.||:|:|||::|...:..||||    |.:::|.|    |
Zfish     9 VRDFNRYITCSICRGYLIKPTAVTECLHTFCKSCIVQHFEESNECPEC----GIQVHETNPLEML 69

  Fly    87 KSDDTLRSLIYKLVPGLYQRECKELADFKEQHDLVDEQTTDEPEFFTTTELISLSLE-------- 143
            :.|.||..:|:||||||.::|..:.::|..:|. :.....|.|.    .:...||.|        
Zfish    70 RLDKTLEEIIFKLVPGLREKEEHQESEFWRKHK-IKSNGEDGPR----AKKSRLSGEDDDGNGGD 129

  Fly   144 YHP-----AMLHQC--GPGEVPPTI-------YLQCAAGLPVELLKRFLCSKYNIETDNGLVEVE 194
            ||.     |:...|  ..|:...:|       :::|:..:.|..:|:|||.|..:.:.   .|::
Zfish   130 YHRSDPQIAICLDCLRNNGQSGESIVKGLMKKFIRCSTRVTVGTIKKFLCVKLKLPSS---YELD 191

  Fly   195 VTYKDEVLPTNFTLMDVAYCYNWSRES----PMAFCYR 228
            |....|::..:.|| :..|...|..:.    ||...||
Zfish   192 VLCNGEIMGKDHTL-EFIYRTRWRLQGDSAYPMVLEYR 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Su(z)2NP_001260933.1 zf-C3HC4 35..73 CDD:278524 19/37 (51%)
RAWUL 143..228 CDD:292824 23/110 (21%)
pcgf5aNP_001122184.1 zf-C3HC4 18..56 CDD:278524 19/37 (51%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 97..130 7/37 (19%)
RAWUL 155..228 CDD:292824 16/76 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170593694
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2660
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1203951at2759
OrthoFinder 1 1.000 - - FOG0000290
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.750

Return to query results.
Submit another query.