DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Su(z)2 and pcgf6

DIOPT Version :9

Sequence 1:NP_001260933.1 Gene:Su(z)2 / 36432 FlyBaseID:FBgn0265623 Length:1396 Species:Drosophila melanogaster
Sequence 2:NP_001082838.1 Gene:pcgf6 / 555238 ZFINID:ZDB-GENE-060526-178 Length:277 Species:Danio rerio


Alignment Length:240 Identity:58/240 - (24%)
Similarity:104/240 - (43%) Gaps:45/240 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 QNTHNTMESNAAMDAASPASRDVRQFHDLITCRLCRGYMIDPTTVDYCYHTYCRSCILKHLLRAV 68
            ::||...:..|..:.:.|    :|.|:..|.|.||.|:.||.||:..|.||:|:|||:||...:.
Zfish    33 RDTHGAPKQQADDEPSLP----LRDFYPYIRCALCNGFFIDATTITECLHTFCKSCIVKHFFYSN 93

  Fly    69 YCPECKASGGKEINELNLKSDDTLRSLIYKLVPGLYQRECKELADF------------------- 114
            .||.|.....:......::.|..|:.:::|:||.|.:.|...:..|                   
Zfish    94 RCPNCSIVVHQTQPLYCIRPDRQLQDIVFKMVPYLEEDERSRICAFYRLRGLEVPKPVASPAAYP 158

  Fly   115 -----KEQHDLVDEQTTDEPEFFTTTEL-ISLSLEYHPAMLHQCGPGEVPP--TIYLQCAAGLPV 171
                 :::.|||.:..     |...:|| :||.||:..|   :.|.....|  ..|::.:....|
Zfish   159 VKLPQRQKKDLVPQSV-----FTIPSELDVSLMLEFVGA---EKGVENYKPLERKYVRVSGEATV 215

  Fly   172 ELLKRFLCSKYNIETDNGLVEVEVTYKDEVLPTNFTLMDVAYCYN 216
            ..::.|:..|..:..:   .:|:|...:.:|....:|.::   ||
Zfish   216 RHVELFIRRKMELSQN---CKVDVVCGEHILEQYQSLREI---YN 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Su(z)2NP_001260933.1 zf-C3HC4 35..73 CDD:278524 19/37 (51%)
RAWUL 143..228 CDD:292824 14/76 (18%)
pcgf6NP_001082838.1 zf-C3HC4 60..98 CDD:278524 19/37 (51%)
RAWUL 196..253 CDD:292824 9/62 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170593704
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2660
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1203951at2759
OrthoFinder 1 1.000 - - FOG0000290
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.750

Return to query results.
Submit another query.