DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Su(z)2 and pcgf1

DIOPT Version :9

Sequence 1:NP_001260933.1 Gene:Su(z)2 / 36432 FlyBaseID:FBgn0265623 Length:1396 Species:Drosophila melanogaster
Sequence 2:NP_001016417.2 Gene:pcgf1 / 549171 XenbaseID:XB-GENE-6454077 Length:259 Species:Xenopus tropicalis


Alignment Length:251 Identity:65/251 - (25%)
Similarity:116/251 - (46%) Gaps:40/251 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 NTMESNAAMDAASPASRD------VRQFHDLITCRLCRGYMIDPTTVDYCYHTYCRSCILKHLLR 66
            |.::|...||   |...:      :::.::.|.|.||.||.||.||:..|.||:|:|||:|:|..
 Frog    15 NQLQSVYKMD---PLRNEEVVKVKIKELNEHIVCYLCAGYFIDATTITECLHTFCKSCIVKYLQT 76

  Fly    67 AVYCPECKASGGKEINE----LNLKSDDTLRSLIYKLVPGLYQRECKELADFKEQHDL------- 120
            :.|||.|..    :|:|    ||||.|..::.::|||||||.:.|...:.||.....|       
 Frog    77 SKYCPLCNI----KIHETQPLLNLKLDRVMQDIVYKLVPGLQENEDGRIRDFYHSRGLERVLQPS 137

  Fly   121 -VDEQTTDEPEFFTTTELISLSLEYHPAMLHQC------GPGE-----VPPTIYLQCAAGLPVEL 173
             |::...|..:...:..:...:..|:....|.|      ..|:     :....|::|:....:..
 Frog   138 AVEDSVGDVSQLSLSLAVSQKTSHYYRNDEHVCLCLEKVSSGKDKKKFILEQKYVRCSVRSEIRH 202

  Fly   174 LKRFLCSKYNIETDNGLVEVEVTYKDEVLPTNFTLMDVAYCYNWSRESPMAFCYRI 229
            |:|.|..:.:..    |..|::...::|||.:.|:..:...:.:.:.:|:...|.:
 Frog   203 LRRVLSHRLSAP----LAHVQLLIDNKVLPDHMTMKQLWLTHWYGKPAPLVLLYSV 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Su(z)2NP_001260933.1 zf-C3HC4 35..73 CDD:278524 21/37 (57%)
RAWUL 143..228 CDD:292824 16/95 (17%)
pcgf1NP_001016417.2 zf-C3HC4 45..83 CDD:278524 21/37 (57%)
RAWUL 177..253 CDD:292824 13/79 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000290
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.