DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Su(z)2 and l(3)73Ah

DIOPT Version :9

Sequence 1:NP_001260933.1 Gene:Su(z)2 / 36432 FlyBaseID:FBgn0265623 Length:1396 Species:Drosophila melanogaster
Sequence 2:NP_001246797.1 Gene:l(3)73Ah / 48903 FlyBaseID:FBgn0002283 Length:222 Species:Drosophila melanogaster


Alignment Length:221 Identity:61/221 - (27%)
Similarity:103/221 - (46%) Gaps:42/221 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 ITCRLCRGYMIDPTTVDYCYHTYCRSCILKHLLRAVYCPECKASGGKEINELN----LKSDDTLR 93
            |||::|.||.||.|||..|.||:|:||::|||.....||.|    ...|::.:    :..|.|::
  Fly    14 ITCKICGGYFIDATTVTECLHTFCKSCLVKHLEEKKTCPTC----DNIIHQSHPLQYISFDRTMQ 74

  Fly    94 SLIYKLVPGLYQRECKELADF------------KEQHDLVDEQTTD---EPEFFTTTELISLSLE 143
            .::|||||.|.:.|.:...||            .:.|:..:|:..|   |.:|....|.:::.||
  Fly    75 DIVYKLVPKLQEDESRRERDFYKSRNMPCPKDITQNHEDDNEKVMDAHAESDFHRLDEQVNVCLE 139

  Fly   144 YHPAMLHQCGPGEVP--PTIYLQCAAGLPVELLKRFLCSKYNIETDNGLV---EVEVTYKDEVLP 203
                    |......  ...:::|::...:..||:.:..|..    ||:.   |:::...:|:|.
  Fly   140 --------CISNNFKNLQRRFIRCSSQATITHLKKLVAKKIL----NGIEKYREIDILCNEELLG 192

  Fly   204 TNFTLMDVAYCYNWS-RESPMAFCYR 228
            .:.||..| |...|. |:.|:...:|
  Fly   193 KDHTLKFV-YVTRWRFRDPPLRLQFR 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Su(z)2NP_001260933.1 zf-C3HC4 35..73 CDD:278524 20/37 (54%)
RAWUL 143..228 CDD:292824 18/90 (20%)
l(3)73AhNP_001246797.1 RING-HC_PCGF3 13..59 CDD:319649 23/48 (48%)
RAWUL_PCGF3 133..217 CDD:340603 19/96 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467329
Domainoid 1 1.000 52 1.000 Domainoid score I4257
eggNOG 1 0.900 - - E1_KOG2660
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1203951at2759
OrthoFinder 1 1.000 - - FOG0000290
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.750

Return to query results.
Submit another query.