DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Su(z)2 and bmi1b

DIOPT Version :9

Sequence 1:NP_001260933.1 Gene:Su(z)2 / 36432 FlyBaseID:FBgn0265623 Length:1396 Species:Drosophila melanogaster
Sequence 2:XP_021335136.1 Gene:bmi1b / 394249 ZFINID:ZDB-GENE-040116-4 Length:326 Species:Danio rerio


Alignment Length:309 Identity:98/309 - (31%)
Similarity:144/309 - (46%) Gaps:52/309 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 VRQFHDLITCRLCRGYMIDPTTVDYCYHTYCRSCILKHLLRAVYCPECKASGGKEINELNLKSDD 90
            :.:.:..:.|.||.||.||.||:..|.|::|:.||:::|..:.|||.|.....|....||::||.
Zfish    11 ITELNPHLMCVLCGGYFIDATTIVECLHSFCKMCIVRYLETSKYCPICDVQVHKTKPLLNIRSDK 75

  Fly    91 TLRSLIYKLVPGLYQRECKELADFKEQHDLVD----------EQTTDEPEFFTTTELISLSLEYH 145
            ||:.::|||||||::.|.|...||..:|. ||          |.:.::.......|:||||:|:.
Zfish    76 TLQDIVYKLVPGLFKNEMKRRRDFYAEHP-VDATNGSNEDRGEVSDEDKRIIADDEIISLSIEFF 139

  Fly   146 PAMLHQCGPG-------EVPPTIYLQCAAGLPVELLKRFLCSKYNIETDNGLVEVEVTYKDEVLP 203
            .........|       ||....||||.|.:.|..|::||.||.:|..   ..::||.|:||.|.
Zfish   140 DQKKLDGKDGEEKESTKEVTVKRYLQCPAAMTVMHLRKFLRSKMDIPC---TFQIEVMYEDEPLK 201

  Fly   204 TNFTLMDVAYCYNWSRESPMAFCYRILLYDNEQTKNDENNLSRINQDIEPEHSVRRSKSAKSVTF 268
            ..:||||:||.|.|.|..|:...||:      :....:..||....|:.   ..||         
Zfish   202 DYYTLMDIAYIYTWRRNGPLPLKYRV------RPGCKKIKLSSPRNDMS---GGRR--------- 248

  Fly   269 AEDLESEIDSGSPRSKVRCKTPPKVSPSSKNKRLTSSKREAEPESPVSN 317
             .|.||:..|..|.|      |..|:..|.:..:.|      |.:||.:
Zfish   249 -PDTESDSSSDKPNS------PSIVAAPSTSSSMPS------PNTPVQS 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Su(z)2NP_001260933.1 zf-C3HC4 35..73 CDD:278524 18/37 (49%)
RAWUL 143..228 CDD:292824 32/91 (35%)
bmi1bXP_021335136.1 RAD18 10..>153 CDD:333230 48/142 (34%)
RING-HC_PCGF4 14..67 CDD:319650 20/52 (38%)
RING-HC finger (C3HC4-type) 20..58 CDD:319650 18/37 (49%)
RAWUL 162..226 CDD:318447 28/66 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170593700
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2660
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000290
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10825
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
76.800

Return to query results.
Submit another query.