DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Su(z)2 and rnf2

DIOPT Version :9

Sequence 1:NP_001260933.1 Gene:Su(z)2 / 36432 FlyBaseID:FBgn0265623 Length:1396 Species:Drosophila melanogaster
Sequence 2:NP_571288.2 Gene:rnf2 / 327035 ZFINID:ZDB-GENE-030131-5243 Length:338 Species:Danio rerio


Alignment Length:284 Identity:53/284 - (18%)
Similarity:95/284 - (33%) Gaps:100/284 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LQNTHNTMESNAAMDAASPASRDVRQFHDLITCRLCRGYMIDPTTVDYCYHTYCRSCILKHLLRA 67
            ||.|.....::....|.||     |..|..:.|.:|...:.:..|...|.|.:|..||:..|...
Zfish    26 LQRTPQEAITDGLEIAVSP-----RSLHSELMCPICLDMLKNTMTTKECLHRFCADCIITALRSG 85

  Fly    68 -VYCPECKASGGKEINELNLKSDDTLRSLIYKLVPGLYQRECKELADFKEQHDLVDEQTTDEPEF 131
             ..||.|:.   |.:::.:|:.|....:||.|:.|.            :::::...|:.......
Zfish    86 NKECPTCRK---KLVSKRSLRPDPNFDALISKIYPS------------RDEYEAHQERVLARISK 135

  Fly   132 FTTTELISLSLEYHPAMLHQCGPGEVPPTIYLQCAAGLPVELLKRF-LCSKYNIET-----DNGL 190
            ....:.:|.|:|                       .||.::.:.|. ...|:.||.     ||| 
Zfish   136 HNNQQALSHSIE-----------------------EGLKIQAMNRLQRGKKHQIENGSGAEDNG- 176

  Fly   191 VEVEVTYKDEVLPTNFTLMDVAYCYNWSRESPMAFCYRILLYDNEQTKNDENNLSRINQDIEPEH 255
                               |.::|.|.|..|                          ||:..|  
Zfish   177 -------------------DSSHCSNASVHS--------------------------NQEAGP-- 194

  Fly   256 SVRRSKSAKSVTFAEDLESEIDSG 279
            |::|:|::.....  |:::..::|
Zfish   195 SIKRTKTSDDSGL--DMDNATENG 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Su(z)2NP_001260933.1 zf-C3HC4 35..73 CDD:278524 11/38 (29%)
RAWUL 143..228 CDD:292824 15/90 (17%)
rnf2NP_571288.2 zf-C3HC4 53..92 CDD:278524 11/38 (29%)
RAWUL 239..332 CDD:292824
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170593702
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.