DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Su(z)2 and Pcgf6

DIOPT Version :9

Sequence 1:NP_001260933.1 Gene:Su(z)2 / 36432 FlyBaseID:FBgn0265623 Length:1396 Species:Drosophila melanogaster
Sequence 2:XP_008758660.1 Gene:Pcgf6 / 309457 RGDID:1306904 Length:365 Species:Rattus norvegicus


Alignment Length:88 Identity:34/88 - (38%)
Similarity:55/88 - (62%) Gaps:0/88 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 ITCRLCRGYMIDPTTVDYCYHTYCRSCILKHLLRAVYCPECKASGGKEINELNLKSDDTLRSLIY 97
            |.|.:|:||:||.||:..|.||:|:|||::|...:..||:|.....:.....|::.|..|:.::|
  Rat   133 ILCSICKGYLIDATTITECLHTFCKSCIVRHFYYSNRCPKCNIVVHQTQPLYNIRLDRQLQDIVY 197

  Fly    98 KLVPGLYQRECKELADFKEQHDL 120
            |||..|.:||.|::.||.::..|
  Rat   198 KLVVNLEEREKKQMHDFYKERGL 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Su(z)2NP_001260933.1 zf-C3HC4 35..73 CDD:278524 18/37 (49%)
RAWUL 143..228 CDD:292824
Pcgf6XP_008758660.1 RING-HC_PCGF6 131..175 CDD:319652 20/41 (49%)
COG5222 <135..258 CDD:227547 33/86 (38%)
RAWUL_PCGF6 261..356 CDD:340605
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166351897
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2660
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1203951at2759
OrthoFinder 1 1.000 - - FOG0000290
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.750

Return to query results.
Submit another query.