DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Su(z)2 and Pcgf3

DIOPT Version :9

Sequence 1:NP_001260933.1 Gene:Su(z)2 / 36432 FlyBaseID:FBgn0265623 Length:1396 Species:Drosophila melanogaster
Sequence 2:NP_001100715.2 Gene:Pcgf3 / 305624 RGDID:1311479 Length:241 Species:Rattus norvegicus


Alignment Length:231 Identity:63/231 - (27%)
Similarity:110/231 - (47%) Gaps:45/231 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 ITCRLCRGYMIDPTTVDYCYHTYCRSCILKHLLRAVYCPECKASGGKEINELNLKSDDTLRSLIY 97
            ||||||.||:||.|||..|.||:||||::|:|.....||.|:....:......:..|.|::.::|
  Rat    15 ITCRLCSGYLIDATTVTECLHTFCRSCLVKYLEENNTCPTCRIVIHQSHPLQYIGHDRTMQDIVY 79

  Fly    98 KLVPGLYQRECKELADF------------------KEQH----------------DLVDEQTTDE 128
            ||||||.:.|.::..:|                  .:||                :..:|:..::
  Rat    80 KLVPGLQEAEMRKQREFYHKLGMEVPGDIKGEACSAKQHLDPRNGETKADDNSNKETAEEKQEED 144

  Fly   129 PEFFTTTELISLSLEYHPAMLHQCGPGEVPPTIYLQCAAGLPVELLKRFLCSKYNIETDNGLVEV 193
            .::..:.|.:|:.||.:.:.|...      ...:::|:|...|..||:|:..|.|:.:.|   |:
  Rat   145 NDYHRSDEQVSICLECNSSKLRGL------KRKWIRCSAQATVLHLKKFIAKKLNLSSFN---EL 200

  Fly   194 EVTYKDEVLPTNFTLMDVAYCYNWS-RESPMAFCYR 228
            ::...:|:|..:.||..|... .|. :::|:...||
  Rat   201 DILCNEEILGKDHTLKFVVVT-RWRFKKAPLLLHYR 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Su(z)2NP_001260933.1 zf-C3HC4 35..73 CDD:278524 22/37 (59%)
RAWUL 143..228 CDD:292824 19/85 (22%)
Pcgf3NP_001100715.2 RING-HC_PCGF3 14..60 CDD:319649 25/44 (57%)
RAWUL_PCGF3 153..235 CDD:340603 21/91 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2660
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1203951at2759
OrthoFinder 1 1.000 - - FOG0000290
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.