DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Su(z)2 and RGD1562871

DIOPT Version :9

Sequence 1:NP_001260933.1 Gene:Su(z)2 / 36432 FlyBaseID:FBgn0265623 Length:1396 Species:Drosophila melanogaster
Sequence 2:NP_001100405.1 Gene:RGD1562871 / 302366 RGDID:1562871 Length:232 Species:Rattus norvegicus


Alignment Length:149 Identity:45/149 - (30%)
Similarity:72/149 - (48%) Gaps:26/149 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 ESNAAMDAASPASRDVR-----QFHDLITCRLCRGYMIDPTTVDYCYHTYCRSCILKHLLRAVYC 70
            |..|...||..:.::.|     :....|:|.:|:||:||..|:..|.||:|:|||:||...:..|
  Rat    94 EGKAEEKAAVESDQEERLLPLSEMIPYISCSICKGYLIDAATITECLHTFCKSCIVKHFEHSNRC 158

  Fly    71 PECKASGGKEINELNLKSDDTLRSLIYKLVPGLYQRECKELADFKEQHDLVDEQTTDEPEFFTTT 135
            |:|.....:.....||:.|..|::::||||.||.::|.|:..:|.:      |.....|:     
  Rat   159 PKCNIIVHEAKPHNNLRMDPQLQNIVYKLVSGLEEKEKKQRREFYK------ENRGQTPK----- 212

  Fly   136 ELISLSLEYHPAMLHQCGP 154
                      ||.:.|.||
  Rat   213 ----------PAAVPQPGP 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Su(z)2NP_001260933.1 zf-C3HC4 35..73 CDD:278524 18/37 (49%)
RAWUL 143..228 CDD:292824 5/12 (42%)
RGD1562871NP_001100405.1 zf-C3HC4 123..161 CDD:278524 18/37 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166351899
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2660
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000290
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.