DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Su(z)2 and SPCC548.05c

DIOPT Version :9

Sequence 1:NP_001260933.1 Gene:Su(z)2 / 36432 FlyBaseID:FBgn0265623 Length:1396 Species:Drosophila melanogaster
Sequence 2:NP_587745.1 Gene:SPCC548.05c / 2539314 PomBaseID:SPCC548.05c Length:468 Species:Schizosaccharomyces pombe


Alignment Length:263 Identity:53/263 - (20%)
Similarity:84/263 - (31%) Gaps:96/263 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly  1077 GNNNNNNNNNNNNNNNNNNNNNNSTSNSL-EAALNKIKQNISANSNG-------------GP--- 1124
            |.|..::::.|.:|....|.:.|...|:: .|.:..:.|:......|             ||   
pombe   228 GENAESDSSLNGDNTRGGNISTNRAFNNMGHAPITAVPQDWLRFDEGEEFVGSDLESDFSGPGEY 292

  Fly  1125 -------------------------STTSGSNSNGTTNGDDLQNLHMLSESATAREKISIKAASS 1164
                                     :..:|||.||.|..|           :|..|:|.|.    
pombe   293 DVDDGFIDNRATSQLSPVESDDDFVAPVNGSNGNGITALD-----------STDSEEIDIM---- 342

  Fly  1165 GNG------SGSTSSSSAKPKNAN----------ALVRPQNASVRSIPNPSALAFRNQPAAASTA 1213
             ||      ||.|:..|......|          .|...||.|:.|:.:.|    .|.|:..:  
pombe   343 -NGFDEERDSGGTNMVSRSETCYNDGQRYDELRRELADIQNESLDSLNSSS----NNSPSHNN-- 400

  Fly  1214 ASISKPLTVRAEEKPKVSTSNPGSLSPTNTSSSSSSSSSGSSGCS--------AATSPRAMTKKP 1270
                    :.:.:.|..|..:.|::....|...||.|||.:.|..        .|:.||...::.
pombe   401 --------IHSRQHPFSSDEDEGNIVTNGTGLRSSQSSSQNRGFDLEPYSEVFTASYPRRQARRT 457

  Fly  1271 TTI 1273
            .||
pombe   458 RTI 460

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Su(z)2NP_001260933.1 zf-C3HC4 35..73 CDD:278524
RAWUL 143..228 CDD:292824
SPCC548.05cNP_587745.1 RING 84..126 CDD:238093
COG2888 <193..213 CDD:268082
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.