DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Su(z)2 and Rnf2

DIOPT Version :9

Sequence 1:NP_001260933.1 Gene:Su(z)2 / 36432 FlyBaseID:FBgn0265623 Length:1396 Species:Drosophila melanogaster
Sequence 2:NP_001347773.1 Gene:Rnf2 / 19821 MGIID:1101759 Length:345 Species:Mus musculus


Alignment Length:373 Identity:67/373 - (17%)
Similarity:122/373 - (32%) Gaps:127/373 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LQNTHNTMESNAAMDAASPASRDVRQFHDLITCRLCRGYMIDPTTVDYCYHTYCRSCILKHLLRA 67
            ||.|.....::......||     |..|..:.|.:|...:.:..|...|.|.:|..||:..|...
Mouse    33 LQRTPQEAITDGLEIVVSP-----RSLHSELMCPICLDMLKNTMTTKECLHRFCADCIITALRSG 92

  Fly    68 -VYCPECKASGGKEINELNLKSDDTLRSLIYKLVPGLYQRECKELADFKEQHDLVDEQTTDEPEF 131
             ..||.|:.   |.:::.:|:.|....:||.|:.|.            :::::...|:.......
Mouse    93 NKECPTCRK---KLVSKRSLRPDPNFDALISKIYPS------------RDEYEAHQERVLARINK 142

  Fly   132 FTTTELISLSLEYHPAMLHQCGPGEVPPTIYLQCAAGLPVELLKRF-LCSKYNIET-----DNGL 190
            ....:.:|.|:|                       .||.::.:.|. ...|..||.     ||| 
Mouse   143 HNNQQALSHSIE-----------------------EGLKIQAMNRLQRGKKQQIENGSGAEDNG- 183

  Fly   191 VEVEVTYKDEVLPTNFTLMDVAYCYNWSRESPMAFCYRILLYDNEQTKNDENNLSRINQDIEPEH 255
                               |.::|.|.|..|                          ||:..|  
Mouse   184 -------------------DSSHCSNASTHS--------------------------NQEAGP-- 201

  Fly   256 SVRRSKSAKSVTFAEDLESEIDS------------GSPRSKVRCKTPPKV--SPSSKNKRLTSSK 306
            |.:|:|:      ::|...|:|:            |:...::..:..|.:  ...|...|...:.
Mouse   202 SNKRTKT------SDDSGLELDNNNAAVAIDPVMDGASEIELVFRPHPTLMEKDDSAQTRYIKTS 260

  Fly   307 REAEPESPVSNFKSLRSNDMRYSDYAVSKVKSEPEQEQFLLPREREQQ 354
            ..|..:. :|.:.::|        .|:.:::|:.|..|..|....|:|
Mouse   261 GNATVDH-LSKYLAVR--------LALEELRSKGESNQMNLDTASEKQ 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Su(z)2NP_001260933.1 zf-C3HC4 35..73 CDD:278524 11/38 (29%)
RAWUL 143..228 CDD:292824 15/90 (17%)
Rnf2NP_001347773.1 RING-HC_RING2 56..102 CDD:319654 12/48 (25%)
RING-HC finger (C3HC4-type) 60..99 CDD:319654 11/38 (29%)
RAWUL_RING2 234..339 CDD:340687 13/75 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167848279
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.