Sequence 1: | NP_001260933.1 | Gene: | Su(z)2 / 36432 | FlyBaseID: | FBgn0265623 | Length: | 1396 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_021336949.1 | Gene: | pcgf3 / 101884364 | -ID: | - | Length: | 250 | Species: | Danio rerio |
Alignment Length: | 232 | Identity: | 64/232 - (27%) |
---|---|---|---|
Similarity: | 109/232 - (46%) | Gaps: | 46/232 - (19%) |
- Green bases have known domain annotations that are detailed below.
Fly 33 ITCRLCRGYMIDPTTVDYCYHTYCRSCILKHLLRAVYCPECKASGGKEINELNLKSDDTLRSLIY 97
Fly 98 KLVPGLYQRECKELADFKEQ-----------------------------------HDLVDEQTTD 127
Fly 128 EPEFFTTTELISLSLEYHPAMLHQCGPGEVPPTIYLQCAAGLPVELLKRFLCSKYNIETDNGLVE 192
Fly 193 VEVTYKDEVLPTNFTLMDVAYCYNWS-RESPMAFCYR 228 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Su(z)2 | NP_001260933.1 | zf-C3HC4 | 35..73 | CDD:278524 | 22/37 (59%) |
RAWUL | 143..228 | CDD:292824 | 20/85 (24%) | ||
pcgf3 | XP_021336949.1 | RING-HC_PCGF3 | 22..68 | CDD:319649 | 25/44 (57%) |
RING-HC finger (C3HC4-type) | 25..63 | CDD:319649 | 22/37 (59%) | ||
RAWUL | 180..244 | CDD:318447 | 18/67 (27%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1203951at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.010 |