DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Su(z)2 and pcgf3

DIOPT Version :9

Sequence 1:NP_001260933.1 Gene:Su(z)2 / 36432 FlyBaseID:FBgn0265623 Length:1396 Species:Drosophila melanogaster
Sequence 2:XP_021336949.1 Gene:pcgf3 / 101884364 -ID:- Length:250 Species:Danio rerio


Alignment Length:232 Identity:64/232 - (27%)
Similarity:109/232 - (46%) Gaps:46/232 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 ITCRLCRGYMIDPTTVDYCYHTYCRSCILKHLLRAVYCPECKASGGKEINELNLKSDDTLRSLIY 97
            ||||||.||:||.|||..|.||:||||::|:|.....||.|:....:......:..|.|::.::|
Zfish    23 ITCRLCEGYLIDATTVTECLHTFCRSCLVKYLEENNTCPTCRIVIHQSHPLQYIGHDRTMQDIVY 87

  Fly    98 KLVPGLYQRECKELADFKEQ-----------------------------------HDLVDEQTTD 127
            ||||||.:.|.|:..||.::                                   .:..:|:..:
Zfish    88 KLVPGLQEAEMKKQRDFYQKLGMEVPGDIKGELCNMKIHPDSQRNGELKSEDPASKEAGEEKAEE 152

  Fly   128 EPEFFTTTELISLSLEYHPAMLHQCGPGEVPPTIYLQCAAGLPVELLKRFLCSKYNIETDNGLVE 192
            :.::..:.|.:|:.||.:.:.|...      ...:::|:|...|..||:|:..|.|:.:.|   |
Zfish   153 DNDYHRSDEQVSICLECNSSKLRGL------KRKWIRCSAQATVLHLKKFIAKKLNLTSFN---E 208

  Fly   193 VEVTYKDEVLPTNFTLMDVAYCYNWS-RESPMAFCYR 228
            :::...:|:|..:.||..|... .|. ::||:...||
Zfish   209 LDILCNEEILGKDHTLKFVVVT-RWRFKKSPLLLHYR 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Su(z)2NP_001260933.1 zf-C3HC4 35..73 CDD:278524 22/37 (59%)
RAWUL 143..228 CDD:292824 20/85 (24%)
pcgf3XP_021336949.1 RING-HC_PCGF3 22..68 CDD:319649 25/44 (57%)
RING-HC finger (C3HC4-type) 25..63 CDD:319649 22/37 (59%)
RAWUL 180..244 CDD:318447 18/67 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1203951at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.