DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Psc and PCGF5

DIOPT Version :10

Sequence 1:NP_523725.2 Gene:Psc / 36431 FlyBaseID:FBgn0005624 Length:1601 Species:Drosophila melanogaster
Sequence 2:NP_115749.2 Gene:PCGF5 / 84333 HGNCID:28264 Length:256 Species:Homo sapiens


Alignment Length:47 Identity:11/47 - (23%)
Similarity:17/47 - (36%) Gaps:15/47 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 VYVREELPAE---------------LETVTNTTLTNIVRQLSSLSKH 48
            ||||..|.::               ||.:....|:....|:..|.:|
Human    73 VYVRLALSSDAYGGRFFQLVLCGHKLEPLVLVQLSERYEQMEFLGRH 119

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PscNP_523725.2 RING_Ubox 254..341 CDD:473075
RAWUL_PCGF2_like 371..465 CDD:340602
PHA03247 <1160..1381 CDD:223021
PCGF5NP_115749.2 RING-HC_PCGF5 6..100 CDD:438395 6/26 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 94..133 6/26 (23%)
RAWUL_PCGF5 136..256 CDD:340604
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.