DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Psc and PCGF5

DIOPT Version :9

Sequence 1:NP_001286368.1 Gene:Psc / 36431 FlyBaseID:FBgn0005624 Length:1601 Species:Drosophila melanogaster
Sequence 2:NP_001243478.1 Gene:PCGF5 / 84333 HGNCID:28264 Length:256 Species:Homo sapiens


Alignment Length:273 Identity:73/273 - (26%)
Similarity:125/273 - (45%) Gaps:68/273 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   250 RPVLLTAVNPHIICHLCQGYLINATTIVECLHSFCHSCLINHLRKERFCPRCEMVINNAKP--NI 312
            |..|:...||:|.|::|:||||..||:.||||:||.:|::.|......||||...::...|  .:
Human     5 RKHLVKDFNPYITCYICKGYLIKPTTVTECLHTFCKTCIVQHFEDSNDCPRCGNQVHETNPLEML 69

  Fly   313 KSDTTLQAIVYKLVPGLYERELMRKRAFYKDRPEEAALATPEQRGDDTEHLIFSPSDDMSLSLEY 377
            :.|.||:.|::||||||.|:||.|:..|:|..       .|::.|.|.......|..|       
Human    70 RLDNTLEEIIFKLVPGLREQELERESEFWKKN-------KPQENGQDDTSKADKPKVD------- 120

  Fly   378 AELGELKTD------SEPEL---VDTLR--------------PRYLQCPAMCRVSHLKKFVYDKF 419
             |.|:...|      |:|::   :|.||              .::::|.....|..:|||:..|.
Human   121 -EEGDENEDDKDYHRSDPQIAICLDCLRNNGQSGDNVVKGLMKKFIRCSTRVTVGTIKKFLSLKL 184

  Fly   420 EIDAQRFSIDIMYKVKTIVLLDYYTLMDIAYIYTWK------------------RDAPMRFYYRV 466
            ::.:. :.:|::...: |:..|:  .|:..|:..|:                  :|.|:      
Human   185 KLPSS-YELDVLCNGE-IMGKDH--TMEFIYMTRWRLRGENFRCLNCSASQVCSQDGPL------ 239

  Fly   467 YESPQPLVKPAPR 479
            |:|...:::..||
Human   240 YQSYPMVLQYRPR 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PscNP_001286368.1 zf-C3HC4 263..301 CDD:278524 18/37 (49%)
RAWUL 384..465 CDD:292824 20/121 (17%)
PCGF5NP_001243478.1 rad18 8..>116 CDD:273165 44/114 (39%)
RING-HC_PCGF5 16..57 CDD:319651 20/40 (50%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 94..133 10/53 (19%)
RAWUL_PCGF5 136..256 CDD:340604 22/127 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165157890
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2660
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S3210
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1203951at2759
OrthoFinder 1 1.000 - - FOG0000290
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.700

Return to query results.
Submit another query.